CAZyme Information: SDRG_11475-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11475-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		38473.98	6.6891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767173:115940-116998(+)

Full Sequence      

MKLFVPAGLVAFAATSSLAQFQNTCSQQLMDAVAECQKSAGIDDMKAFIPTIKDGAGRDK
YCGNAWAGCAKLKSLAPASDCIFWVWKGWSVNPSKELACPTDQTTTLCTPNRLAVSEGYG
LLYANTVQSNANEQFAYNNETKAIIAKSNGQCLDVYKDNNQFKLHTYACDSKNANQKWTI
ANHKVQHAVHGVCLEADLGHPGAAVGVAPCSGASETNQWFDACERVPKSYVQLRAATGKH
LLEYNGDLYLNPGGHDFNDLFEWGNGLLKSASNGQCLDVYKDGNGQFKLHTYACDSNNGN
QKWTIANNVVKHATHNNICLDADPTYADAHAQVWECTPNNPNQQWTLLQYSK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	5.15e-15	143	303	4	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	3.79e-14	191	345	11	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.50e-12	144	305	4	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	7.91e-12	266	347	3	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.95e-11	187	347	6	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55969.1|CBM13	2.86e-184	1	352	1	347
AIG55485.1|CBM13	2.39e-52	90	335	15	277
AIG56171.1|CBM13	2.20e-49	100	335	494	736
AIG56439.1|CBM13	9.98e-48	100	335	491	733
AIG56170.1|CBM13	1.20e-39	100	335	489	730

PDB Hits     

SDRG_11475-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SDRG_11475-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999737	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in SDRG_11475-t26_1-p1.