CAZyme Information: SDRG_11398-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11398-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269		29800.56	6.4782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767172:264172-264981(+)

Full Sequence      

MKLVLSSLLLAVASAVPLQLCTVDGMFLSEYEKSLYADVRRNNKNEHFDYDPTTKLLKAT
SNGQCVCAESGKLVTEKCDPNDASQHWEVDLNHVFAPGAYSCLQTSTPGVPVGLAKCVWE
TSITAGQFLTDCSTGVPEYVTITSVSKNRLLEFQTGLYARPSEDIANQVFAWDKANKMLK
SASNGQCLDAFKDANGKVQVHTYACDVKNSNQKWNFNPSTKTLEHATHAGQCLDVDHSDF
HVQMWACVPGNTNQMWTITSYNAEARRKW

Enzyme Prediction     

No EC number prediction in SDRG_11398-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	138	264	7.6e-16	0.7127659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	8.78e-17	179	256	48	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.35e-13	167	259	30	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	6.56e-12	178	262	4	88	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.42e-11	162	258	30	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.17e-09	102	214	13	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55485.1|CBM13	1.12e-45	21	258	45	289
AIG56170.1|CBM13	6.69e-36	16	254	492	738
AIG56438.1|CBM13	9.66e-34	16	254	491	741
AIG56171.1|CBM13	3.95e-32	18	254	499	744
AIG56439.1|CBM13	1.35e-31	20	261	498	748

PDB Hits     

SDRG_11398-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SDRG_11398-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999757	CS pos: 15-16. Pr: 0.9661

TMHMM  Annotations     

There is no transmembrane helices in SDRG_11398-t26_1-p1.