CAZyme Information: SDRG_11289-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11289-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44032.51	9.2972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767171:344576-345772(-)

Full Sequence      

MRTVALLFAVLFAATAVEALDQKLYGINYTPRKGPDYFSLKKRCKNATEIDRDMVQLRKI
TDRIRIYSMTDCNTADLVIPAVRRAGMSIWVGLWVGPNNTVYAEEKASLVKQLKNGNVNN
QTLGLHVASEAIYRKDINVSTAIADMNEIRSIMNAADVYIPITITDIADTYIQYPQLVKA
VDIVSANSFPFWELAVAETAAQKMYNRMYPLMLSAQKYKKKILISETGWATNGTSNGASI
ATPSTGATWLNDFYFLAKDVQWDYYWYTSYDTPWRHLEGDNTTAEVENYFGLYFLNNTLK
PVFANMNFTRRVNLVTKMPLPKTNATATLAPVAGATTTVAATTTVATTAAPATTVVDATT
VPVVTASVAANATGNTTEPHKKSKILSILEALVRGWMF

Enzyme Prediction     

No EC number prediction in SDRG_11289-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.10e-36	43	293	58	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAY53769.1|GH17	1.11e-263	1	398	1	398
AIG56392.1|GH17	4.47e-214	1	398	1	405
AIG55390.1|GH17	3.79e-184	1	398	1	393
AIG56195.1|GH17	2.09e-88	9	335	4	336
QBC18032.1|CBM13|GH17	1.25e-72	10	306	13	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.69e-26	21	301	34	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.16e-25	21	301	34	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43070|BGL2_CANAX	5.47e-19	44	300	35	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	1.02e-18	44	300	35	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|O13990|BGL2_SCHPO	5.44e-16	44	309	55	319	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	1.17e-15	43	303	36	297	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	1.99e-08	26	293	128	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999762	CS pos: 19-20. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in SDRG_11289-t26_1-p1.