CAZyme Information: SDRG_11058-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11058-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	JH767169|CGC1	65795.65	6.7537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767169:554167-556063(+)

Full Sequence      

MASLPRATRSLHPLRFLIETRFMLLFLVVLSAGLVFWALGDDMEGIDASVELHADRVHAL
WTDETYQCLGWRATANCNPHGWRKPSRDRGCSDVIEPGMSGYCEIRNRTSGEIFQVMLTA
CDSIKDKTFTCMEARDFTDYSIRAASAPAVSPSTPMLRTFANATNGIVMSIYPSVLPNVY
AIVRMLRFYNCMLPMELWYEPHQMSDVATNPILAALEANYGPLVFRPIADKRATGYMTKP
FAVAHSQFENVLFLDSDNLPTRDPTFLFTSPQFLESGAIFWPDYWHDSSSPFNVHARSLL
WELVDMPFVDMLEQESGQLVVARHRCATALAKVLHYALETPPLLQKYGLVWGDKDLFRLA
WFNTSTPFAFVPHPPALGGFTKDEYVDAVAPVPSVLYWHAVSFCGIAMLQHDFDGRILFV
HRNSVKLTGEADQTPLVTHAQTSTLPTHASPLLGHGKEYFIQLFGHTLGQKACYVLASAG
RIEAVDAIDDSMAKVEKMAIHYAIEAGDMLRAVARRRKEHGAGHWLLPFDTLDARHTGED
AIPVMYWVTVHMLVGGLAGWTWRRRQRSVTKGPTLDRAIPPPYQIL

Enzyme Prediction     

No EC number prediction in SDRG_11058-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	165	412	2.1e-47	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	7.77e-31	166	412	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	247	284	89	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	5.49e-118	42	476	54	469
CCA20955.1|GT71	4.27e-114	51	510	83	552
CCA25306.1|GT71	8.18e-114	39	510	43	536
UIZ28362.1|GT71	6.43e-112	47	510	647	1105
UIZ29182.1|GT71	2.18e-86	43	510	43	490

PDB Hits     

SDRG_11058-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	4.82e-11	183	360	264	489	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	5.90e-11	180	413	186	441	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.64e-09	180	414	165	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.16e-09	180	414	165	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AP90|MNN23_CANAL	2.21e-09	230	360	246	413	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000049

TMHMM  Annotations     

Start	End
21	40