CAZyme Information: SDRG_10855-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_10855-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1517	JH767168|CGC3	168633.50	5.8437

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767168:526823-532017(+)

Full Sequence      

MSSGCARRWLAAAMALVLAMTVAGSRKVEVDLTTTYLSSPVYPVLETSAFLAEVDPSLFF
RYVDAIDMRAKAIQHIDSINYTTLALDAAHDVLPPDATIAKLLPFVLQTRAQSPKIEMFH
QLAIESAYKGCGLAYEAASAWAVVYHETGCAARVICAASNWNDALLTPSTDASCAASGEH
DFELPVDHVFDKDVADAPTVLLYGTLGTSSLRAFHAKLAPLAEAKTIRYIVRHAPHNNVL
PVHLQGYGVSLHIKNMEYKSFDDSKTPHSKHTPTDDDEDAFIVSVLMKKGAETGPALRAY
QLEFEDFSSVNATENNEDAPWQLNHLGYLAASDILASTDPLARLQQLSQNFPKYAAGLAL
TTELIPSERVAAMATARRTVATQNLLNKLVVNGMPHDLSDVTFNPFDFVKLLAGEVQQGD
ALRALELDDPTLAAVHSAMTTLSTQAAEVRVRVRGPVDGTAPLYLNAIESDEATAEWPTD
LSVLSEPAWNLIFLRRVMYEVIVVLDPTTKQAANVLQQIQFLILRGAPVQFGVLWTSPEL
LALAPEDRETYVPATDDKAPATAYHVSKLYLAARDHGHAAAKQFLDGIVELAGGVTVKEA
LLIYVQAVTHRLDRGSALEAARDLLLSASQDDSVWAMTDVVLASQLPLDSYVFNGVLRRD
LNLQEGLMAHFGRDQPLYQELARAGKFADDADLLDELFAHEGHYPLYSSWLDASEQVPVL
DLHLTSSVWDDVKYLHMPHTATKPKRQSLLLMVDLDTPAGARSAYNALKTTMETPDVRLS
LVHLGTSPSSIGSRVSYMLHAISDVDDARYLAILLEIVRFLSKAKSEADIVLHAKLLVQT
HLDASPEEARLRDLLRWLDETPAYTHPLPSLLSITTPTLLINGRPLSLDDDQTLLPSLLS
VLLQWEGENRSKAVARAFFAPTKHDALSVAAAAHVSQRLQSLLAVVDAYLATPRTGPVFS
TLDQHTTFATSAASRSLLDVVAYLDPLSEASQRASVVLRMMRDVLGAKITLVLTPTPSYA
EFPLKRFYRYAWGSAPVFRVLPRPPVLTMNVETPELFNVQMVASDTDIDNIQGDATAMYA
VQSLLVYGQCIDRTMAYHPSPPNGLQLVLERTAGADVLHRDTVVMKNLGYFQLQATPGVW
RLELAKGRASELYEMVDQAATDHARVIVYDFSSAITQLDVKKRRGYEYARLLEEPEDLPA
AKKEEDAATQSYWKSLVSWGTKQPVKDVVAARSGETIHVFSVATGHLYERMLKLMMLSVL
KRTNNPVTFWLLENFLSPDFKKSVPALQAEFGMDIRLVTYKWPNWLRRQTEKQRIIWGYK
ILFLDVLFPLGVQKIIYVDADQVVRADLKELWHMDLHGKPYAYTPFCDSRNVGFQFWRQG
YWKDHLRGKPYHISALYVVDLVKFRRMAAGDTLRAVYDQLSADPNSLSNLDQDLPNYAQH
QIPIHSLPQEWLWCESWCSDESKASAKTIDLCNNPKHKEPKLDMAKRVISGEYFKESWLE
LDDQVKAAEAAYTARHS

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1237	1482	4.7e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1237	1507	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.35e-165	1237	1482	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.31e-56	1237	1477	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.02e-28	44	235	5	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	4.82e-25	458	695	9	232	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56125.1|GT24	0.0	1	1514	1	1507
AIG55512.1|GT24	0.0	9	1512	12	1515
UIZ20865.1|GT24	0.0	12	1515	12	1663
CCA14500.1|GT24	0.0	25	1514	35	1667
AIZ94008.1|GT24	6.54e-198	187	1506	216	1595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	3.96e-154	22	1515	5	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	7.54e-154	22	1515	5	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	1.04e-153	22	1515	5	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.13e-139	669	1515	386	1218	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	7.53e-127	25	1444	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	5.16e-197	26	1502	31	1562	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	2.20e-182	7	1512	26	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q09332|UGGG_DROME	1.49e-181	36	1506	38	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	4.56e-179	23	1512	42	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	8.12e-179	10	1512	29	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.011422	0.988551	CS pos: 24-25. Pr: 0.8862

TMHMM  Annotations     

There is no transmembrane helices in SDRG_10855-t26_1-p1.