CAZyme Information: SDRG_10853-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_10853-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33192.21	6.5768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767168:522176-523111(-)

Full Sequence      

MKPIYLGSLLALLAVSVDAHGRMIAPPARGFMGRLDQFNFAPIDYDDDGLSAGGIGATSG
GRHGVCGDPYSQASPRDHETGGKYGLFPTYRERAITSCYAPGAVVDIDIQITANHRGSFT
FGLCKLLGKNDKETEDCFTDLLQPNGNKQWPLPGGNKNFRLQYVLPSGVTCDGDAHCVLR
WWYTGGNNAGVGPDGQEKFWNCADIYISNACNGTNPFPTPVPTHQPSPDDGSGGYYPPTP
TTKVPTPTLVPTVTPRPTATAAPTTSASPPTGAPGDKCNGQKNVCYWPTSHQIVPYSKAD
CVLFSSFVWCP

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	205	1e-53	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	9.25e-14	20	205	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EQC31690.1|AA15	2.70e-227	1	311	1	311
KDO27652.1|AA15	1.85e-209	1	311	1	311
KDO27651.1|AA15	1.21e-119	1	311	1	303
EQC31691.1|AA15	5.23e-118	8	311	38	311
KDO26031.1|AA15|CBM1	1.81e-110	8	231	7	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	1.98e-30	20	208	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

SDRG_10853-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999693	CS pos: 19-20. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in SDRG_10853-t26_1-p1.