CAZyme Information: SDRG_10847-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_10847-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	JH767168|CGC2	34647.98	8.2136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767168:471163-472134(+)

Full Sequence      

MKLFASTLLLAAAVSNVDAHGRMVFPPHRGYIGKLPQFKDLVPINYSDNGLSAGGIGATS
GGKHGVCGDPYNGARAHESGGTYGLFPTHGSKVVGACFAPGATMDLNIQITANHKGYFEF
GLCKLNGKGDKETEECFQSLTQPNGDKQWQLPAGADFFKMQYNLPKDVKCDGDSHCVLRW
WYVGWNNPGVDINGQEQFWNCADIYISDTCGSDPKPSPSSQNPTPAPSSDKPTKAPVTDK
PTPVTDKPTKKPTPTDKPSTKPTSKPSIKPTDKPTAKPISGGGKKAWEQCGGKDYTGSTE
CVGGSICVTQDEWYSQCVPKRLR

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	204	1.4e-53	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.03e-13	20	204	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
395595	CBM_1	9.70e-10	286	314	1	29	Fungal cellulose binding domain.
197593	fCBD	5.83e-09	285	318	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
236940	PRK11633	1.08e-06	215	278	86	145	cell division protein DedD; Provisional
223880	TonB	1.65e-06	214	278	50	113	Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EQC31684.1|AA15|CBM1	6.91e-211	1	323	1	323
KDO33855.1|AA15|CBM1	1.84e-170	1	323	1	337
EQC26015.1|AA15|CBM1	1.48e-168	1	323	1	342
AIG56514.1|AA15|CBM1	2.48e-159	1	323	1	309
KDO18684.1|AA15|CBM1	6.19e-158	1	319	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	1.63e-23	20	207	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MM92|CEL6A_MAGO7	8.40e-08	287	319	32	64	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=cel6A PE=1 SV=1
sp|Q8NJ73|XYN6_MAGGR	9.29e-08	287	319	22	54	Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea OX=148305 GN=XYL6 PE=1 SV=1
sp|G4MPQ7|XYN6_MAGO7	9.29e-08	287	319	22	54	Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL6 PE=3 SV=1
sp|Q5AR04|MANF_EMENI	1.04e-07	289	319	24	54	Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manF PE=3 SV=2
sp|B2ABX7|CEL6A_PODAN	1.12e-07	287	319	31	63	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999769	CS pos: 19-20. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in SDRG_10847-t26_1-p1.