CAZyme Information: SDRG_10680-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_10680-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
998		113062.48	8.1054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767168:102711-105901(+)

Full Sequence      

MATDKYAMNATPAGKVETEMSDDNSIKVFGWMHKQGTRAFKGPVAKSWRRRFFCLEGNKI
YYFHEPVDARKYFNSRKSELCIGTVDLRGAFKLEQSSRLDLPSKGIEIHTKRRVWLLCPE
TDADFNMWFDALEMIIITAGSGNVVVRQLPNVREYVMKGRTSYRFFYFLFLITAIVELAG
IILWFPLGIEPCDLLHRNDTCVNIFKRYSAENQPVCGPKPFNGMWNPPQWYWTQAGMTNV
QCFREPVLAHWVSYFMFYFAEFISILLGALYYLGMWKPVRRGAQYLKDFNPPFPSDKWPS
VDILLCHYAEPAEDTMATLDAILKLDYPPEKLHVYICDDGAFKTKFTPGNPIPDVIVNQG
VIENAGDVRYELAHFMYEKVLDLDGDGQGIGYTRAAEMEVNEWRRSHTTVKLPTPENPRV
CERVDCAIGSERDDYDYRYAGLPRVTFVGRVKPPTHHSKAGNINNVLYNEKASGQYAIIL
DNDMKPHPMFVQATLPFFFDSPSSTKTFRCSAPGCSDIAKISCTLCVQAGVPEANISYCS
KECFDAANHAKSDIHRRQTRSSRAKRTQCSGCGGTVNQKTGECKSCHNNYGRRSSIGTVQ
NNQVMLAMDDHYSDDVRKNQVGYVQTPQYFEDCLQLRLGDPCGHRNSTFFDSAQTGMDGY
ECASFAGTNAIFRRSALDSVSGIAYGSLTEDAFTGKLMIDKGWKGLYFRKDFEGEEGDRI
RLAEGAVPETVAASLAQRKRWAKGNFQIFLRRKKSLVDPTWSPPTVELPPPRKVNRFMRW
VFFMNLTIYPIGSFPALFFFYITGYFLYSGNAPIYTAGLRLLVALVPKIVIQTILSAMMN
RTVDNNDVMRSQETWFSYAFVHVVAVFDAIYWKITDKEAAWANTGALGGNSTMELPNVFV
FFAIVFGVIWSVVRFFVGYNNAETTHGTPLVFGSLFLGIFTASQLGPMVRMSLQTYFGWS
HKSLTDQGNVVGSFGLAIVLSIICLWVYIETPHTNFWG

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.86e-35	299	749	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	2.97e-17	259	749	225	492	cellulose synthase catalytic subunit; Provisional
224136	BcsA	5.01e-15	619	872	166	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	1.15e-13	620	751	113	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
214574	PH	4.53e-12	30	136	5	101	Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP96909.1|GT2	0.0	19	998	65	1022
AEZ51040.1|GT2	0.0	26	998	80	1032
AXF53810.1|GT2	0.0	19	998	62	1019
ABP96913.1|GT2	0.0	26	998	69	1019
ABP96905.1|GT2|2.4.1.12	0.0	26	998	69	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.93e-12	616	749	378	505	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
7D5K_A	1.93e-06	682	990	733	1024	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	9.04e-23	429	863	568	880	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.64e-12	616	749	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|O82859|BCSA2_KOMSB	2.66e-12	616	749	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	2.66e-12	616	749	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q93IN2|BCSA_SALTY	6.60e-12	616	955	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

Start	End
165	187
254	276
781	803
813	835
855	872
895	917
930	952
967	989