CAZyme Information: SDRG_09980-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_09980-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33901.47	6.6777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767164:139150-140139(-)

Full Sequence      

MPNVLASLGLCSAVKPYSYSLAKVQFPHLKNAIEVVETQPIATWYTDRDPDSKHQAALAV
GNCPKGSRPTIVVYGLPNKDCQDHQSTDGANKTPEQYAQFLTDLTTTVGDNNVVYILEPD
AVGLLVGGSACATTFEYERNLINAVSLLGRNPRADIYVDIGFWVLGKANDGKIARVLSTL
DPTGTRLKGISINTSNFRTTAELVNMCGNFSATAMATANRTVTCVLDVSRNFAGPDPMSQ
WCNPKGRGIGRPPTITSGERLVDYMLWIKPPGESDGNCNGGPTAGAFFLDGFVELWNNGY
FVQVKGMQKVSAIAP

Enzyme Prediction     

No EC number prediction in SDRG_09980-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	27	279	3.1e-55	0.9251700680272109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.92e-38	27	283	2	292	Glycosyl hydrolases family 6.
227616	CelA1	1.11e-20	63	300	180	440	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55974.1|GH6	1.94e-168	2	315	17	329
UIZ23635.1|GH6	1.17e-87	4	311	17	323
CCA20052.1|GH6	2.87e-75	17	311	3	310
AIG55947.1|GH6	7.03e-74	7	313	16	312
AIG55492.1|GH6	2.34e-70	6	311	17	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	3.35e-32	66	298	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	3.35e-32	66	298	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	3.35e-32	66	298	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	5.18e-32	66	298	89	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	1.62e-27	36	295	33	282	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	4.90e-27	30	298	194	446	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26222|GUN2_THEFU	7.90e-26	36	295	64	313	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	3.94e-24	27	298	61	320	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	4.83e-23	34	280	105	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P33682|GUN1_STRHA	1.42e-22	36	287	65	309	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SDRG_09980-t26_1-p1.