CAZyme Information: SDRG_09152-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_09152-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973		108836.69	8.8713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767160:213495-216716(-)

Full Sequence      

MSRRNYAPPARGGSGPRPNMNPANMGPPPQMPMQQGSGRNLRAPPPRQVQQQGSFDRDSD
DDMYMQHGANGVLGVPVWQDSAAYEHGSYLQENTPPSQRIQYPGPQGGGMMPPPGGMMQP
QFAPAPVRMLNAAASQNQWNQQMQVMRDSNVGQAVPASTPEAFRIIASGVTAETEARYQS
AVNDFLAGGEMLALVSEREADPHIRSLLNTKAIQVLEWSKKLHDWYQQGMRGSVPRRFVG
KLGVNVVNRLGACAGRIDAGSTSELRTMYYTPAANKVVSEFTKDGYRLQCIEEGRTPQLM
VVITMYNEDQVEMYSTLKKVANNIAHIKSQKLPGYEGDDAWKNILVVIVSDGRTKANKGT
LAFLRDVGAFDEDVMNIMMVGVDVMCHVFEFCVQLKKAKTIEASASSSERYPPTQVVFAL
KEHNGGKLNSHEWYFNAFAEQIQPEYTVLLDVGTMPTAKAFYLLLCAMEIDPQIGGTCGE
IAVDKPIPHLCNWVIAAQHFEYKISNVMDKSLESVFGFISVLPGAFSAYRYKAIRGAPLE
AYFKSLTTPMNELGPFQGNMYLAEDRILCFELLARRNCRWTMQYVKDAIARTDVPTDLVA
LIGQRRRWLNGSFFALVYTILNWGRVYTESNHSYIRKLFLCIQYAYMTANVALSWVLPAN
FFLVTYFLVIVGFKSNNWGYIPTSGIPDKTKDIIVQVFSLLYGTSFLIQLVAGLGNKPKH
IKGVYRLTAVFYALVMLLTSVIAFGFIMKPWIDSLRSGMPFATMVTSFEIKDIAAFVASV
GVFFLASCLHCEMHHIAMSFIQYMCLLPTFVNILNTYSFCNLHDLSWGTKGLESSDGHGP
KAGGGGNYKDAAEAKKAEEARKKKEGEIKDKMEGDFQYFRSKLLIFWLLSQMGFAYLIIS
FDSVNGQEGANYLKFLFYIVAGFNLFRLFGSTYFLLIEARICVEKMCIRGTMRDRLNAKK
KKQAIRAAQTQHV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	305	468	3.1e-51	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	6.70e-77	301	615	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	9.20e-61	305	468	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	3.46e-29	297	752	54	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	6.57e-21	445	682	203	434	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	8.59e-20	301	565	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE62520.1|GT2	2.71e-295	146	964	87	877
ACA96933.2|GT2	1.64e-245	146	934	12	787
QKE45457.1|GT2	2.85e-239	158	961	36	825
ARC77249.1|GT2	7.35e-223	158	931	93	843
ARC77251.1|GT2	1.46e-222	158	931	93	843

PDB Hits     

SDRG_09152-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	3.75e-149	264	884	208	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P30595|CHS2_RHIOL	1.82e-132	264	938	151	854	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30588|CHS3_NEUCR	1.33e-126	256	938	173	883	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30594|CHS1_RHIOL	9.22e-126	256	938	141	854	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|Q99127|CHS4_USTMA	4.96e-125	256	936	241	935	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

Start	End
608	627
651	673
693	715
728	747
773	790
878	900
915	937