CAZyme Information: SDRG_08887-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_08887-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	JH767159|CGC3	38477.46	5.1561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767159:20530-21606(-)

Full Sequence      

MFSHCLPRARAHYPICRLISTTAMKSYLASLALALVAIVALPQADAARVVGMYYPNRPEA
PRIEDVQLKASTHVFYAFVIPNADGSLPTPEGLAHFAQVVRSKGAKPVLSIGGGGQSANF
PPLAASAASRNTFVQAVRSLVNKYNLEGVDIDWEFPDSDSDFNNYRVLAQQVRQALGAGK
VVSAALPGWISRDQMAPIVNESLDFVNLMLYDNVYSNDGRPNAALMGDDSSVQSAVGNWL
GAGVPASKLVVGVPFYGYEGKKAITYRDIKPLESSWEFFMNEASFTPQLVQDGRTITYDN
PTSITAKAKFTACMNLRGVFAWEVTQDDADGSLLNALGTSYPGGNGNSDACLEEATST

Enzyme Prediction     

No EC number prediction in SDRG_08887-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	49	332	6.6e-56	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	3.02e-63	49	327	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	2.55e-59	48	327	1	334	Glyco_18 domain.
119365	GH18_chitinase	1.30e-51	50	327	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119358	GH18_plant_chitinase_class_V	1.46e-46	51	333	7	299	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
119351	GH18_chitolectin_chitotriosidase	5.83e-39	72	337	29	358	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55659.1|GH18	6.42e-140	32	355	12	334
UQU63378.1|CBM13|GH18	7.00e-38	60	344	50	323
QFU91314.1|CBM13|GH18	1.27e-37	38	346	36	328
AGZ40037.1|CBM13|GH18	5.46e-37	60	344	32	305
ALG15088.1|CBM13|GH18	6.55e-37	63	346	72	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4URI_A	1.96e-29	63	327	15	322	Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia],4URI_B Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia]
6TSB_AAA	8.19e-28	74	330	57	340	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.08e-27	74	330	76	359	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6JM7_A	2.63e-25	63	339	25	369	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6KST_A	9.87e-25	65	327	27	357	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	1.48e-22	65	343	58	397	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	1.48e-22	72	341	65	395	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|A0A1B1J8Z2|CHIT5_LOTJA	2.94e-22	72	327	77	382	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
sp|A6N6J0|CHI46_TRIHA	3.96e-22	72	341	66	402	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	7.00e-22	102	327	120	384	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.024524	0.975460	CS pos: 46-47. Pr: 0.8964

TMHMM  Annotations     

There is no transmembrane helices in SDRG_08887-t26_1-p1.