CAZyme Information: SDRG_08483-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_08483-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
960		107283.92	8.2233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767157:136316-139749(-)

Full Sequence      

MDPRAVHRPSMVHGMRNRAVLQPSTPPSQIPLIICAYYLPLLLVKEGHGKFRAEPTGDAL
LASTHAFSHEDLFRVGSTRRKIKFVGCLDVSFEIAPHEEAEVCRVCAEYFCTPVFITNDA
DRMIFDAFCKQSLWPAFHGIVHPDGMPGAFTQAAPAWPAMLNINRDIATTLAKAYEPGDH
IWLQDYQVSFVPMYLHRLLRLTPPPVGLFFHVPFPALSVFRIVSTRAELLKSMLQANLIG
FHLYEHAKNFLSACKVLLGISSPAMVQGQFGIEYGGRRIAITCSQLTVDGARLEKQLGTA
AVTDQVIAYRQAYPRKMLFAGVDVLDPFHGVLGKLAALELFLDSNPAQQTRIMLLQFGVL
TKFLGTPDYYEQVQAVVDRLNAKYPEPVVVFHLTRRNLTCAERLALWRVAEVFVSTVLQE
GLNISAFEYIVAHRNATGIAILSERAASSRLLHGALVVNPWDVTAIAKAMATAVHMPAKE
REFRRDCDLVTIGAHSPVRWAYCVVSDIAKAAAIVKAGTHFLPESPVVLTLLQEEKFLDL
YRKSSRRVFFFDYYRTLAPDVSSDFGIVWPDVPVSVLSSLEILCRDKRNSVFVVSGCNCE
LLSDKFGSVPGLGLVAEHGYFLRWAYLGHSARIDKPWELYGDVFRVNAACGKWREKAQVI
MQVYVDRTNGSALEMRRSSILFRYAKSDPEYGLMQAMDLKEQLEAQLANWPLSIIQGKDY
IEVRPDGLGKGKIVGQILNKLRKDSETPVDFVLAMGDDVADELMFEAVDAFSKAIHIPTV
VTCTVGHKATQAQYFLEDQLQVVTLLNNIRLALTKSNRNYSVSDMQTMLGRHMHHTPQIS
FTSTPPSLVVESCSVSRKNSAKTLRSGLTPVLEEDHAGSSESLVRGGGWRWKRFTFLALC
LGYGLYRHRRSVQKTWKKWAALATVLAILAAKATASDETDDVDNVTHLRRLSSESFRDEE

Enzyme Prediction     

No EC number prediction in SDRG_08483-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	32	509	3.1e-98	0.9663157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	8.67e-127	75	809	100	844	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	1.81e-125	32	809	3	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	6.41e-98	75	821	46	795	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	1.06e-94	31	507	1	461	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.02e-89	32	507	3	467	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	1.10e-243	29	859	21	876
CCA16404.1|GT20	3.43e-197	34	882	8	892
CCA19238.1|GT20	6.06e-138	32	839	265	1106
UIZ24099.1|GT20	3.41e-129	32	826	292	1135
CAG1832582.1|GT20	9.86e-119	28	831	57	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	1.59e-58	24	513	6	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	4.12e-57	104	513	75	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	3.61e-56	104	482	64	436	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	9.47e-54	107	510	71	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	9.47e-54	107	510	71	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	1.57e-110	75	809	105	850	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O80738|TPS10_ARATH	6.26e-107	3	809	28	839	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	1.92e-106	77	820	99	850	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	2.10e-106	77	809	97	834	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LMI0|TPS7_ARATH	1.36e-105	3	817	28	841	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000048

TMHMM  Annotations     

There is no transmembrane helices in SDRG_08483-t26_1-p1.