CAZyme Information: SDRG_08436-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_08436-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	JH767156|CGC2	94753.56	8.0406

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767156:539961-542498(-)

Full Sequence      

MVSSQLSTGLPAIARRPSVRSTRVGSHVRNDNDCVTTVDAFRYIERGVRAEYDMFYSEAI
NCFVNAGECLLIVAEQNDDDVSQMLLAKSQEVIGWAEELSIWLENGRAGPLPSRNCRGIQ
IPFTKEYEGGEHYEEAAELSYTPVATVNPINFTLDGYRMQCVTRGRKPTMMLVITMYNED
GAELAQTLRKVCNNVKYIQKNALPGYEGDDAWQNIVVCIVSDGRTKANPSATSFLREIGV
FNEDAMTIFSSGAATQMHLFERTVRLAKDPHNKQSVIMSNNSTIGADYPPLQMVYALKEH
NAGKLNSHLWFFNAFCNQVDPEYNILLDVGTLPTKAALYKLLATLEMKADIGGVCGEIAV
SRPIPNLWNFVIATQHFEYKVSNLLDKATESCFGFVSVLPGAFSAYRFAAIKGAPLQAYF
KSLTTDMAELGPFYGNMYLAEDRILCFELLARTNGAWKLKYIKDAVARTDVPSTLVDLMA
QRRRWLNGSFFAMLYSIVQWGRLYSHTNHSILTKAGLMIQYFQLLVQLFFGWFMCGFFYL
SVYYVVFTTLKKSKLPFWDSEEWYDDHHSMAMSIFNIVYAFLIMVQIVFGLGNKPKHVQW
LYTFLSVFYAVVVITAVFFSVCSLSSHNGMSPFNIVLLAATFGVYFIAAAFHFELHHVVF
TFVQYLVMLPTTINILMIYAFCNIQDLSWGTKGLGDSAGHGPLKGGGQRLGSGGYSDLVA
QRKAAEAAARHDAVVADQVKRRFDSFRSYTLLFWLISNALLIMTCIYFVGANVFLPSLFL
FIALFNVTRLLGSIAFVVATGRDWVLLKLCLCSGGMAKRKQKKEKVKDQDGFGALDSSKV
LRHSA

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	176	343	8.1e-52	0.9815950920245399

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.10e-73	174	492	3	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	8.20e-61	176	341	1	159	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	6.72e-23	257	619	67	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	7.90e-20	319	690	197	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	1.00e-14	261	412	13	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKE45457.1|GT2	0.0	1	845	1	845
ACA96933.2|GT2	0.0	15	840	8	830
ADE62520.1|GT2	8.62e-260	36	836	103	885
AEZ51041.1|GT2	1.27e-208	28	800	66	831
ARC77249.1|GT2	2.05e-204	28	794	85	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	2.29e-09	36	103	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	3.55e-134	96	748	159	786	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P87073|CHS1_PHYB8	9.56e-121	110	762	118	789	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30572|CHS2_CANAX	4.47e-117	135	777	276	956	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30597|CHS1_SCHPO	6.79e-116	135	762	154	806	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2
sp|P30594|CHS1_RHIOL	1.30e-115	134	796	148	850	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000071

TMHMM  Annotations     

Start	End
525	547
568	590
600	622
629	651
661	683
751	773
778	800