CAZyme Information: SDRG_08083-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_08083-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	JH767155|CGC1	55324.16	6.9732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767155:240771-242333(-)

Full Sequence      

MARNVIALVLMAVAVTVLGQSSTGIATTYGGPEGSPPGDGNCNLMDWLPMSTNGYHVAIN
TVQWALGKHCGRCVQIQCVDSGCTTNAVAVAQITDHCPGCENGDLDMALPIFQATTGHTT
GRWKVQWSFVDCPVQGGVKICAKVGSSQWWLAVQPTNTVNGVASMSVNGPTCPLFGGTAY
YFQAQQTAPLGSTQISMTSFSGDTITANVALQPGQCTQLTQQFKTGGASPPNPQPNPQPQ
PQPAPQPAPASVPVAPMSVASRLQLPLTLTTSTSKGILEYYSGIYMGDNTYSSNFVWTYN
AGTQQLQSRSAPNQCLDAYRGGDGNMYLHTWTCDASNSNQKWIVSGSSVKHATHNNLCVD
ANPSTANNAVQVWPCVLGNSNQMIAVASVMLHVGISLRSQNVVFAANQDSSVSFRPPSPS
FNALASDQGALWTFDHMQNTIKSELTGLCLDAYLGSNGAPVHTYSCSLSNGNQQWQYDPS
SKAIKHMIYKGFCLDMDLGSKKAQLWQCNGGASQQFGYEK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409004	DPBB_RlpA_EXP_N-like	1.04e-20	23	129	2	94	double-psi beta-barrel fold of RlpA, N-terminal domain of expansins, and similar domains. The double-psi beta-barrel (DPBB) fold is found in a divergent group of proteins, including endolytic peptidoglycan transglycosylase RlpA (rare lipoprotein A), EG45-like domain containing proteins, kiwellins, Streptomyces papain inhibitor (SPI), and the N-terminal domain of plant and bacterial expansins. RlpA may work in tandem with amidases to degrade peptidoglycan (PG) in the division septum and lateral wall to facilitate daughter cell separation. An EG45-like domain containing protein from Arabidopsis thaliana, called plant natriuretic peptide A (AtPNP-A), functions in cell volume regulation. Kiwellin proteins comprise a widespread family of plant-defense proteins that target pathogenic bacterial/fungal effectors that down-regulate plant defense responses. SPI is a stress protein produced under hyperthermal stress conditions that serves as a glutamine and lysine donor substrate for microbial transglutaminase (MTG, EC 2.3.2.13) from Streptomycetes. Some expansin family proteins display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs.
395527	Ricin_B_lectin	1.89e-17	351	516	6	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.58e-14	355	516	9	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	3.24e-14	305	475	4	126	Ricin-type beta-trefoil lectin domain.
409008	DPBB_EXP_N-like	9.88e-14	22	132	1	117	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56276.1|CBM13	2.15e-241	16	520	16	520
AIG55598.1|CBM13	1.65e-239	22	520	19	524
AIG55713.1|CBM1	5.06e-75	18	233	13	228
AIG55595.1|CBM13|GH17	4.71e-62	263	509	299	544
AIG56230.1|CBM13|GH17	9.44e-56	263	520	246	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JCW_A	2.53e-09	20	223	1	198	Crystal structure of Clavibacter michiganensis expansin in complex with cellopentaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4JCW_B Crystal structure of Clavibacter michiganensis expansin in complex with cellopentaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4JJO_A crystal structure of apo-clavibacter Michiganensis expansin [Clavibacter michiganensis]
4JS7_A	1.14e-08	20	223	1	198	Crystal structure of D78N mutant apo form of clavibacter michiganensis expansin [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4L48_A Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4L48_C Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6YYW5|EXP32_ORYSJ	1.72e-07	26	169	47	206	Expansin-A32 OS=Oryza sativa subsp. japonica OX=39947 GN=EXPA32 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999794	CS pos: 19-20. Pr: 0.9825

TMHMM  Annotations     

Start	End
5	27