CAZyme Information: SDRG_07576-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_07576-t26_1-p1
• CAZy Family: GH1|GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650		71407.33	5.8395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767153:172253-174724(-)

Full Sequence      

MSDEFELAGRNFSAGHDHLWMALDIPDGVNRAIEVYKPENANTKDGLCSIRVDSKEIDIS
YYNVWANVPGWTGKKMYYAAAMMQTWNKFCIQGGFVEVAAKLPGALNKGSMNPHVTGQRT
TSQGTKPVKTLDPIPDVRFYPTWPGLWMMGNLGRALFSASTNKMWPWTYNECTELSRKNQ
RISACNKSPGFGLNPGQGRGAPEIDILEGGGTAISSSVQIAPGMPDDYRPMPPLLKYENT
SNVDAQGRHGVGHLFCFYEKQCLTLGANMADVPTSAFASRGHKSWYQGLRYAANNRCTPD
STKVQQYASVAAAQNAVLVDNQFDIKTISSGRDRHADLSLIDGKGQYHWGINYNGTCFPI
ANGYMGGFLCDRDSQNPKCEQPRTNAQALTKMMEPFEYQMDAISANWDVSYEAYTTFYKY
QLEWYDATVQTAKVMGNDGYVRWTLDGAPIFEIPASTMTDPPQGTDSGASYNPKKIMIEE
PSYFIFNVAMSSAWGATPPNWQVGPCRGNATMPTPGSDDAKISSNVCDSFPMYMYIDYIR
VWQDTTTMSYGCDPPTHPTKEFIKAHIANYTDPLNPDIAVAGGAMCKSDDDCTVVTSSTG
SCVNRRCSCVTAWTGPRCTKYSIDGSSSYGPSIVLAVALVAFAVVASVDN

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	3	243	3.3e-67	0.6441717791411042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	2.94e-45	2	573	122	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	5.73e-42	2	543	4	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	6.34e-07	413	542	156	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	3.79e-04	76	228	101	224	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	0.003	36	151	35	103	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55703.1|GH16_2	1.36e-313	1	634	57	701
UIZ27810.1|GH16	8.81e-205	1	642	98	725
UIZ28149.1|GH16	1.89e-198	1	632	62	669
UIZ28151.1|GH16	4.28e-197	1	637	63	686
UIZ28152.1|GH16	2.13e-196	1	647	51	681

PDB Hits     

SDRG_07576-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	6.27e-26	2	222	383	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	1.68e-24	2	222	331	522	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	2.20e-23	2	222	360	549	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	6.81e-23	2	209	356	528	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	6.91e-23	2	582	243	615	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000002

TMHMM  Annotations     

There is no transmembrane helices in SDRG_07576-t26_1-p1.