CAZyme Information: SDRG_06705-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_06705-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		64693.16	7.1068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767149:544088-545836(-)

Full Sequence      

MAGAFAARVWLCPSSAAQCCHFPIAIKMRITSILASLAAAATSVMALDRQLYALNYASCP
DDTNMPLDLDKLKDITHTVRMYSMDEACMTRLYWHAGWRNMKIWLGIWSEADAKIDSFDG
EFQRLKNLVEKGMVNNNNVVGIQVSSEAIYRYYIQGQHDFADKGPINRIIKHYKDVKAYL
RSKNLFFPVVITDIMDSYKYFPELYANTDVVSVNAFAMWQNKTAVEGVPTLYNDFQGIWN
SARALGKPVVLSETGWATGGTASVVAETSPEAQALYTKEFISFAEQQNVNYYYFSSFDGN
RDPEIERHFGLFDNTRTMKPLIASLTVGAAPTAVRLHSDANVLKAGSYKQGESFGKLSIS
APAKGLTDRLDNEIWFYNQADSGWLKSRSTNACLQGNGKGQFVSVARCDAAKASQRWSFN
GNGAQIGNLCLTKSLKLATCSNDNKGLTKVDMGSQELRIAVAGSDLELTEYYGALSVRSA
PMAGAIPETQLWYYDPMLQTIKNKANQNSCLDAWEFKDYGGVHVYNCDATNDNQQWQYND
KTGQIMHARKLGLCLSSDASNGNVYLLSCDVNNAGQRFQMNL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	59	319	2.1e-22	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.06e-23	58	316	58	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	4.88e-16	489	578	37	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.80e-11	500	581	2	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.05e-09	500	581	4	85	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.13e-08	490	578	31	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56445.1|CBM13|GH17	2.59e-315	28	582	1	550
AIG55423.1|CBM13|GH17	6.68e-305	28	582	1	554
AIG55614.1|CBM13|GH17	9.46e-295	28	568	1	542
AIG56029.1|CBM13|GH17	1.12e-132	28	578	1	557
AIG56030.1|CBM13|GH17	1.64e-122	27	582	2	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.03e-24	52	320	42	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.41e-24	52	320	42	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

SDRG_06705-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.865760	0.134247

TMHMM  Annotations     

There is no transmembrane helices in SDRG_06705-t26_1-p1.