CAZyme Information: SDRG_06486-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_06486-t26_1-p1
• CAZy Family: GH17|CBM13|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	JH767148|CGC2	64507.61	6.8006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767148:771814-773617(-)

Full Sequence      

MYSISYVSGTQLVTSLSEVDDFCAEKQAPRRWLSKRLLGLVTALVLVAIIVGVVTTCSAT
QDVTNATELRLGATALDMAIGYDTYQADQIDAHFAKIATRFSGVRSFQTWLPNNDNVIAA
AARHDLVVYAGIWLRGGGVYARDVQAAIDGAWRHPGTVKAVFVGNEELSNGWSPDQLIRT
INDVRAKFNAAGLGHIRLGTVQIDGDLLKYPQVADVCDIVGANMHAFFSSAPYSNTDPMR
DTRARWDAIVAKFGTKAIITEVGWPFAGGSYGSHVASYEMGVSYFNAFSDWVRQGNGGPL
PAYFMFHNNPSKIGFEAHFGLADANANWITSPDDIQFLLQTATGTVIYEMHKSLFAYVES
PCANERWRFNRTTNQIVSISSGQCLDAYFANARFYVHVWPCDASNQNQLWTIDATSNTIK
HRVHNNLCLDVDPTKADASVQVWSCHGGSNQQIRVVLDLPHLGLQSQQTKSVLVGSNDRI
AFRNANRDASAAWTFLQSKHMLLHEASGMCLDGYEFKNGGAVHLWRCDATNGNQKWIYDS
NTLQLRHGTRPEFCLDVGVGASPYLYACHGKNDPYISFQQFALVP

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	362	497	5.4e-16	0.5425531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.20e-22	375	536	4	126	Ricin-type beta-trefoil lectin domain.
227625	Scw11	4.23e-20	87	310	62	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	9.81e-17	423	581	8	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	5.28e-16	380	537	8	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.02e-15	361	452	30	125	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56197.1|CBM13|GH17	1.09e-135	75	581	26	547
AIG55595.1|CBM13|GH17	2.05e-132	78	581	18	556
AIG55519.1|CBM13|GH17	3.22e-123	78	582	18	550
AIG56230.1|CBM13|GH17	2.02e-121	153	581	48	504
AIG55518.1|CBM13|GH17	6.49e-111	80	576	22	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.37e-10	104	327	69	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	5.61e-11	70	323	308	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	5.61e-11	70	323	308	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	2.72e-09	64	323	289	549	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999648	0.000355

TMHMM  Annotations     

Start	End
37	59