CAZyme Information: SDRG_05257-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_05257-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	JH767144|CGC2	38375.03	6.4898

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767144:872617-873813(+)

Full Sequence      

MPRLTALVLLVLTAMASALDFRLYGLNYNSRQGADWDPKKCKSQDQIETDLSKIKRISDR
VRIYSLADCNQGPMVLAAAKKLGLKTWLGMWVTNQATFDTEMKVLQTMVSSIDASVEGIH
VGSENLYRKDVTAEQAISFVTTVKTFLTQQQIKIPVSVADIVDALVQYPTVLDAVDVIQA
NSFPFWEPANIDTAMINFKIKMDMLTKVAKGKEIQISETGWASGGVNANASTASADNQAT
YLLNFYNYATEHNLKYYYFAAFDDAWKATLPNKKNDVEAFFGLYDSTGSLKPKIAALVQT
NSSIDPDNTTITVLPLTKTPMPVSPGSKPAPSTATTASIALVSTVLAAALLA

Enzyme Prediction     

No EC number prediction in SDRG_05257-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	39	291	5.1e-25	0.9485530546623794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.34e-44	16	286	40	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.99e-09	25	291	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	1.00e-181	9	330	8	331
AIG55438.1|GH17	6.18e-165	1	346	1	369
AAM18482.1|GH17	2.70e-71	16	314	21	331
CAJ90910.1|GH17	5.91e-67	10	305	11	321
AIG55390.1|GH17	7.78e-67	4	332	8	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.96e-45	24	294	38	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.84e-44	24	294	38	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y429|BTGC_ASPFC	2.14e-24	43	292	405	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.14e-24	43	292	405	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|P15703|BGL2_YEAST	3.65e-24	5	291	9	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q0CI96|BTGC_ASPTN	5.05e-24	19	291	354	641	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|P43070|BGL2_CANAX	6.39e-24	11	294	12	303	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999753	CS pos: 18-19. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in SDRG_05257-t26_1-p1.