CAZyme Information: SDRG_05176-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_05176-t26_1-p1
• CAZy Family: GH16|GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		29213.29	6.6581

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767144:612635-613402(-)

Full Sequence      

MRSWVQHHPTWRYVFWDDDANLALFARHYPQYYAAASSVGKIHLADMARYALLHRFGGVY
VDCDFESTLPLDDLINEDLFLSTEPFVHAVLLERADDAILCNAVLASRRGHPFWLEVLDA
ILVKFQAGGAKQDPVSLTGPRLVEAVFHNFDAHRAGARVTVFPEEYFYPEIAYWNLGRLL
QLCRDRLDPLGRKACNWLRDHPKGLHTTKTHAVHHWQCTWCRGDVGQAVMSLRAIFPDVT
IHRPLRGDDDDAVLL

Enzyme Prediction     

No EC number prediction in SDRG_05176-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	2	77	1.2e-16	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	8.03e-13	2	81	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	4.24e-12	2	170	104	255	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
368570	Caps_synth	8.81e-04	2	125	70	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ26039.1|GT32	4.69e-31	4	220	41	288
UPR05240.1|GT32	4.69e-31	4	220	41	288
AQW50986.1|GT2|GT32|GT62	1.30e-27	3	233	30	237
ASQ94832.1|GT2|GT32|GT62	4.41e-27	3	233	30	237
AUN93720.1|GT2|GT32|GT62	1.26e-25	2	224	24	227

PDB Hits     

SDRG_05176-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.28e-11	1	118	78	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.51e-07	5	121	87	193	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	7.73e-07	1	118	85	196	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	8.29e-07	1	114	103	206	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	8.93e-07	8	121	83	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SDRG_05176-t26_1-p1.