CAZyme Information: SDRG_04980-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_04980-t26_1-p1
• CAZy Family: GH16|GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		63409.58	7.4498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767143:911086-912813(+)

Full Sequence      

MKVPSSLPLLALCLASSAALDRSLWGINYDTRTSEWGGCKDQAVITADLTALKTVTNVVR
LYSMKQPCVDRVFKAAKNLGLKVWIGTWSEVASPKVRDSFDEDFKVLQGLVKSGAITNQN
VAGIQVSSEALFRYYINGGAGVNDTANTNGADAMIAHLNQTRTFLRQNKLDFPVTIADVM
DIYNNYPKLYDAVDVVSVNQFSMWENVDAANGAFTMWQHWQKIEAQARAAGKPVLMSETG
WSSAGNNTAIKEASPDAERIFTRDFLTVAEQMQMNYFYFASFDLSFGDNVIERNFGIFDV
DRKLKDPVVKANVGKAPIAVRLFSGNKVLKADGYLTSTYTRLSMDTPATGAGLDSEIWFW
DPTTSVLRSKSANQCLDSYGSNDWQNVHLWNCDFTNKNQKWKIENNAVKTQNGANFCMDS
DPSMKYDDGKQKVQMWWCWNGPNQKITMRPISAEPIQIKLGGKAWLSASGAAVSTAQTSA
SWFYDPIAQTISTKEKTCLDLATYARDTPVKATACVANSATQKWQFNDVTGQFNHGTSLA
LCLSGSSKTADVVAQLCDKSDANQKWAVSMTNPTA

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	26	305	4.5e-18	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.95e-26	15	302	36	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
238092	RICIN	1.66e-11	367	445	46	121	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.29e-11	367	445	48	125	Ricin-type beta-trefoil lectin domain.
214672	RICIN	7.56e-10	357	445	32	114	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	8.17e-10	482	566	40	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55960.1|CBM13|GH17	0.0	1	575	1	576
AIG55545.1|CBM13|GH17	0.0	14	575	11	575
AIG56029.1|CBM13|GH17	5.58e-165	1	575	1	566
AIG56030.1|CBM13|GH17	2.59e-160	11	570	13	575
AIG55846.1|CBM13|GH17	1.68e-127	10	569	14	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.31e-22	22	305	35	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.09e-22	22	305	35	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

SDRG_04980-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999770	CS pos: 19-20. Pr: 0.9589

TMHMM  Annotations     

There is no transmembrane helices in SDRG_04980-t26_1-p1.