CAZyme Information: SDRG_03549-t26_2-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_03549-t26_2-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		49945.48	8.0245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767139:792308-794178(-)

Full Sequence      

MADATITYFGGMAEILEVKVYRALWHVCRPFVQWLVASKDLRRRVPLAATNERFGVTTTT
ADVFPSTGSGLVWIHGASVGECLSALPLIHALTHMHGARTASGTQRLDVLLTTTTPSARA
LLQERLRANPHAHCIFAPLDHLPFVQAFLSTWQPTAAIWVESELWPNMILEAAKRKMPMG
LVNGRMSATSFGRWNSWLGRRLAQHLLAPFASLTLCQSPEDLYRFQALGVTSAKYVGDLK
FLSAKQAVNAAARARLEDALQGRCVWVAVSTHDGEEAICVRAHMEIRRAHPGALLLLIPR
HPHRCDAIQDGIHTTTPLRTQRRATDSTPKPDTDVFIVDVIGETQLYFDVSPIAFVGGSL
VDVGGHNVLEPLRSGCAVLHGPHMDNCTSVLATLATIAAPIHCVDEASLASHVTRLLSTP
TPSRCTSADATAPVQDALWAALAPFLERITQTSARGQSL

Enzyme Prediction     

No EC number prediction in SDRG_03549-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	50	242	7.5e-48	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.30e-113	21	448	6	423	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.63e-108	21	446	5	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	1.66e-53	52	241	2	174	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UEM05359.1|GT30	5.12e-75	20	456	5	421
ACJ00963.1|GT30	1.07e-74	20	454	5	428
VBB69814.1|GT30	1.12e-73	16	418	7	390
AUN29941.1|GT30	2.14e-73	20	448	5	421
SNY92128.1|GT30	3.48e-73	16	418	7	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.04e-29	70	418	41	345	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.86e-12	248	391	27	170	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	9.30e-52	15	384	5	364	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|P0AC77|KDTA_ECO57	8.69e-49	70	418	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
sp|P0AC76|KDTA_ECOL6	8.69e-49	70	418	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
sp|P0AC75|KDTA_ECOLI	8.69e-49	70	418	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
sp|Q4UND5|KDTA_RICFE	1.42e-47	40	418	64	428	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SDRG_03549-t26_2-p1.