CAZyme Information: SDRG_03023-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_03023-t26_1-p1
• CAZy Family: CE9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		44475.02	5.2952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767138:338913-340471(-)

Full Sequence      

MTTPRADFARLASPLHNTSGRATPLDDDDPAVLPPRESQLSALCLRRAALPVLAMAGLIV
GILAAVGTFNPDNNQAVTTGSDALTAPTPSVTLAPTPKPTPSTKAASPSPTSADGSCPNR
GTHLVGNSCVSCPAPKKTFGVFWESQVDCSSFASSSAAAYVTHIYWSFALIDAASGTVSS
SFQGSDATLKACLAQTRAKCIKNYISIGGATMRQTFVALNSTAQIATFASTAAQVVQKFG
FDGVDIDDESGNLLAAGDWKANVAPSVVAYLTALKTQLGSLPRAATEPAYQITWDEFPTS
LNPDCNTPTGDFQRCFDPRIAGIVDHVNLMMYNAASSTDYDTYLTTTTPTLWTKTVNPMQ
IILGGCVGPVGTLGGCAFGAAPTSTQLSAYASQGAAQYGGAMLWTASADMTTNQGATLVA
MGKAGGYTNSG

Enzyme Prediction     

EC	3.2.1.14:5	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	155	364	2.2e-21	0.5574324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	7.51e-16	160	332	25	209	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	8.59e-16	160	333	23	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	3.50e-13	161	333	23	176	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	2.71e-11	167	276	34	140	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
214753	Glyco_18	6.72e-11	160	332	25	184	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55900.1|GH18	1.49e-154	55	392	1	337
AIG56010.1|GH18	3.59e-59	125	427	76	382
ALN55759.1|CBM12|GH18	1.83e-06	172	279	316	420
QCW24758.1|CBM12|GH18	1.84e-06	172	279	320	424
QQQ00791.1|CBM12|GH18	1.84e-06	172	279	320	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KZ6_A	6.54e-06	180	276	55	150	1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]
3N11_A	8.61e-06	180	276	52	147	Crystal stricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]

Swiss-Prot Hits     

SDRG_03023-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999658	0.000357

TMHMM  Annotations     

Start	End
48	70