CAZyme Information: SDRG_02786-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_02786-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46140.26	9.1015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767137:873434-875075(-)

Full Sequence      

MGKEANIVAIAVLSRAWVSTMAMISAYLITPYDTSATSSSIFRAFATWDGVYYVDMAADG
YGYENTHAFFPLFGLLARYASVLLAPFCAPQTAILVAGWCISNVSFVLAARYLYRLGQLL
LQNETLARRSAIFFCFCPSGIFMSSCYSESLMCVLSFGGMYYLELYRTSAPHRSSTLYLV
LSAILFGLSSATRSNGILLSLYIAYYRLLASPSPTQALISFLRYWVVTALLGVVAIGPQL
VYFAFGIAAYCPSLSPYTASFASLVGLTSKLAIDRPWCANVVPNVSAMYMFIQKEYWGVG
PFAYYQLKQIPNFALATPMLLLSSYALLSYWRPRTRSAAVVLPSPLQPYMAHLAFLLANA
LVVLHIQVLTRFLCANPPIFWAAGHLSMTHPTASKGLLLYALGFSVLGAVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in SDRG_02786-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	22	419	2.1e-96	0.9606879606879607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.67e-40	11	419	8	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.80e-12	39	417	64	406	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	2.53e-119	4	419	6	439
CCA18790.1|GT76	3.30e-92	3	419	5	490
BAF29832.1|GT76	1.90e-56	5	419	6	486
BAT17237.1|GT76	1.90e-56	5	419	6	486
BAG93531.1|GT76	1.90e-56	5	419	6	486

PDB Hits     

SDRG_02786-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q290J8|PIGV_DROPS	4.09e-36	48	419	66	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9V7W1|PIGV_DROME	1.93e-30	48	419	62	449	GPI mannosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=PIG-V PE=1 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.52e-29	48	386	66	420	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q2GSI6|GPI18_CHAGB	5.78e-29	39	417	72	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	4.58e-28	48	419	66	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.870670	0.129332

TMHMM  Annotations     

Start	End
7	29
66	88
95	114
141	163
184	206
221	243
311	333
353	375
396	418