CAZyme Information: SDRG_02663-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_02663-t26_1-p1
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		40007.73	8.4329

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767137:482217-483480(+)

Full Sequence      

MSRLRWLSFRNWPSTSMNKGTKIAIAVILLLGAVFGILGGVGVFSSSTSVSDKATPDNQT
KANGSSTSPTPATGTAAPGSLPDVVANSSAREGHLDRPASCKIVPPGKRVAAFWMTEIGG
CETIPDGVTHVYFAFAEIQAGLVNQSFQTSEANMTACVSALRKRCILVLGSIGGANASKY
MKTVKDPQAFADSAMALIKKYKFDGIDMDDESVGPEFDGVRVLAYMKALYAAMKANGNNY
LLTYDAFMYEGNLDTCKSATYIRCWPVGLEKYLDWVNVMAYNINDNPASANGMYAAATKP
GDIFSRWATLVTAPKVMIGTCSRDGDAYGPCASAAVVSQWTKWATNYGGMMVWAGSKDVK
YNYEVLTNIIKSQ

Enzyme Prediction     

No EC number prediction in SDRG_02663-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	123	319	3.4e-25	0.5743243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	6.48e-19	114	284	8	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	1.32e-17	125	319	20	219	Glycosyl hydrolases family 18.
214753	Glyco_18	5.52e-17	125	281	23	184	Glyco_18 domain.
119365	GH18_chitinase	1.42e-15	125	281	23	209	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	2.82e-15	129	281	29	188	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC44030.1|GH18	9.05e-11	106	295	40	245
UBZ06919.1|GH18	7.10e-10	122	302	47	240
CCG99494.1|GH18	5.50e-09	105	302	27	243
BAD98525.1|GH18|3.2.1.14	1.00e-08	129	305	51	238
ANS10044.1|GH18	1.31e-08	82	305	10	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MNJ_A	2.97e-10	129	305	29	216	Crystal Structure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
3WIJ_A	7.09e-10	129	305	29	216	Crystal structure of a plant class V chitinase mutant from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta]
4MNL_A	1.27e-09	129	305	29	216	Crystal Structure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta],4MNM_A Crystal Structure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta]
1D2K_A	2.61e-08	126	300	27	227	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	6.15e-08	126	300	27	227	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B1J8Z2|CHIT5_LOTJA	2.45e-09	82	305	26	263	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
sp|P0CB51|CHI1_COCPS	1.45e-07	126	300	62	262	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	1.45e-07	126	300	62	262	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|C5P230|CHI1_COCP7	3.41e-07	126	300	62	262	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|P48827|CHI42_TRIHA	1.41e-06	122	282	58	240	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995150	0.004874

TMHMM  Annotations     

Start	End
23	45