CAZyme Information: SDRG_02625-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_02625-t26_1-p1
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		88085.75	7.0920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767137:327426-329929(-)

Full Sequence      

MSRESTPLLGTPAPPNNGNKRFTYAKVAVGAALAVSAVAMFAWSGPSTATVVQANQTSAL
ATTLTPATAPTTTPAPTPRSDPNAPLADWAGEEMEPPFTKMTNLITPKLHAPTWKGAIPS
NAWWTNFLIADGHGEHLGEGQVTLTPYTVIGLNRGLQVSYGDDRRVGDNAIIQEYFADDV
VFGSNPAPTTRQVVRFDSLHARLEFKRAGHHGTFTALLSRGSPYLSVDYKGMVPSLSFGG
AVGAITQVNGVAVNDKTVLTLTKSHFHFHTRIERNLVQEWLVFFPSNVTLRVDAHTATVQ
AASFYGIVRAALVPQGEKKAEFKALLHRSANVVPVAASIRVGSAKNTGAVEFAWKTKQMT
PNASTIENEDLLMLAFPHHVDAFGDATGVNVSSVMNTRPDITATSSDFKVLGRYGHRTIK
GNLTAVVGSAWTLLEPLTTTGFFSQRPIDPKRVHDISAALDKDASYRPSASDPYFFGKEL
ARQARLVLIADQVHNWAVRDSLLAKIEGWLTRWLTLQNSDFFVYDTVWGGVCSSVGIQGM
FYMTDFGNGWYNDHHFHYGYLLYSAAVLGRYKPAFVMAHKAALHTIVRDIANFNIQDPYF
PLARHVSWFDGHSFASGVYVLDGGKSQESVSEAINAYYGVYLLGQVLAMPDLEQFGRVLL
AMEMRAAQTYWQTTPEIYGELYAKNQMTGQVGQTKVSYATWFGPVIEHMHLINFMPFTPI
TEEFFTPEYVQKEYKVLYDGAVSRKESPMEEIWRGYAFLDHAIIDPVAAWDEVQTLKSYD
DGNSRSNSLYWVATRPTK

Enzyme Prediction     

No EC number prediction in SDRG_02625-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	111	791	7.8e-147	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.13e-83	450	789	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	8.85e-75	116	789	88	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.45e-28	107	442	4	316	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
176179	enoyl_red	0.008	241	416	41	204	enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	1.44e-189	96	795	71	815
CAN97272.1|GH81	5.11e-116	81	796	64	718
AGP40408.1|GH81	6.56e-116	93	796	55	702
AUX36386.1|GH81	3.40e-115	93	796	66	713
UIZ24045.1|GH81	1.96e-112	94	592	74	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.57e-58	109	796	31	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.51e-58	109	796	56	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.66e-56	110	796	32	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.57e-35	414	792	279	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	6.19e-25	403	792	291	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.37e-51	80	793	179	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.86e-48	155	793	117	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	7.99e-43	118	793	35	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.62e-39	116	789	432	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.01e-37	372	771	355	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.861217	0.138783

TMHMM  Annotations     

There is no transmembrane helices in SDRG_02625-t26_1-p1.