CAZyme Information: SDRG_01899-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_01899-t26_1-p1
• CAZy Family: CBM13|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	JH767135|CGC1	83318.72	6.1205

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767135:572044-574590(-)

Full Sequence      

MKLYLPLALVAAVAVAQDFDAQAEAIVAKMTPSQWIGQMAQANIGVILGSDGQLSVNAVT
QCAKAGVGSFLNGAMPAAKWRAMITQIQAIYKANNAPPALYGLDSVHGANYVNDAILSPQ
QINKGATFNAKIVQDSAFITARDTSAGGVNWVFAPGLDVTNHKRWSRVYETFGEDPYLAS
ELGIAAVNGIQSVPGVAAAVKHFIGYGATSSGDDRAPAYLDDYQLLNYHAPPFIAAIQSA
NALSVMASYVSVNGVPMVANSRLTNDLLRSDIGFNGLLLTDWEDIYNLNYVHKLVSNNQD
AVAMSMSKSSVDMSMIPNDLSFIGYAQNLLNAGTIAASRYRASAKRIIKMKLQLGLFETP
VPGANNVNLVGGASDRQASLELARESIVLLKNKDRVLPIRSNASVFVTGPAHDNIGYLCG
GWTWEWQGVSGNAKFPGSQSVLSAFQSLVAANGGKVTSLQGVDINGGTTDSLADAKAKAG
AADYTVIVVGETPYAEMVGNVPDAALPAGQLQYIRDIASTGTKVILVLVEGRPRLLNGVA
DVVHAVIDAMLPCHMGGQAIAEIILGLTNPSGRLSMTYPKDQTKDNMVTPYFQRKNGVCV
LTGAACPAEWEFGTGLSYTTFSYTNFALSGNQLNTSAESLTASVVVTNTGTMAGKEAVLL
FLSQGARTSGTPETKMLKKFTKVSLSPGQSTTVTFSIGFNDFAIYSGGIGSGLLKSAEAG
AYYVGVKPETVCDANTIGPLCQSFNYGAVAATIPLSLFAKTTGKIVGATDWDTFMYAPPT
GATPVNQQLDSE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	97	315	3.2e-58	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.13e-90	17	724	32	748	beta-glucosidase BglX.
224389	BglX	2.21e-68	39	423	2	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	9.91e-49	36	348	6	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.87e-48	99	697	90	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.46e-29	387	618	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56285.1|CBM13|GH3	0.0	1	789	1	812
AIG56284.1|GH3	0.0	18	759	19	753
AIG55915.1|CBM13|GH3	0.0	1	789	1	799
AIG55751.1|CBM13|GH3	0.0	1	789	3	793
AIG55594.1|GH3	6.37e-303	15	570	14	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.17e-122	29	703	23	720	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	1.90e-74	98	578	123	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5XXL_A	4.40e-72	17	697	8	712	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	7.20e-72	26	724	10	716	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	2.19e-71	17	697	8	712	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	9.29e-138	20	703	77	792	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.34e-121	29	703	45	742	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	4.96e-75	97	733	66	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	6.82e-72	20	697	35	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	2.33e-70	20	697	35	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999768	CS pos: 16-17. Pr: 0.9527

TMHMM  Annotations     

There is no transmembrane helices in SDRG_01899-t26_1-p1.