CAZyme Information: SDRG_01586-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_01586-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44030.76	8.8876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767134:1193270-1194475(+)

Full Sequence      

MKSILALLALVPLATMAKSVPDWQVCNSATDTCASKGWVCCVAADTPNSKTKTCRSGASQ
CLSSVPKSFAGANSYFLHTLVDSDRREVLDQLKASGFKTVRIFLSRTGAKTKGANNVGVN
DVENPVGKYDDSILKLVDKLIRDVYDRNMKLIIAFHDRWSLGCWDTDAYVTKYKLPTTTS
CQQHANIANDFYTRGDAQADFDNRIKHILAHRNPYFNNRPWSELSEAIMGFEPQNESQGG
LESGTTMPNPQWLCNRAKTIRNAVSNRKILVMSGGGTNYGVSQLTEYFTCPALDVVAIHS
YEGANVNKLKSAVQLANVHKKRVIFEEFGASGSNKASGLAAYSAAANAAGVPWMVWQVLK
PSNHGDFETWTDEKDAWAALANAARQSNGRKGAWSWPELNK

Enzyme Prediction     

No EC number prediction in SDRG_01586-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	361	6.4e-106	0.9858657243816255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.25e-04	87	334	28	242	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56430.1|GH5_31	8.58e-183	68	400	18	350
AIG55497.1|GH5	5.17e-156	5	399	3	452
AIG55732.1|GH5	1.36e-82	1	205	1	208
CCT65393.1|GH5	2.44e-82	68	396	32	365
QRC93078.1|GH5	3.36e-82	65	400	61	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	5.48e-06	82	329	60	332	Exo-mannosidase from Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]

Swiss-Prot Hits     

SDRG_01586-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999743	CS pos: 17-18. Pr: 0.9575

TMHMM  Annotations     

There is no transmembrane helices in SDRG_01586-t26_1-p1.