CAZyme Information: SDRG_01491-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_01491-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		63064.34	8.0789

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767134:983687-985542(+)

Full Sequence      

MLARWLGRAKAAPSRAEYIIVGGGSAGSVLANRLSKDHSVLLLEAGKSDKGHWDSWKMKM
PAALTFNLADARYNWAYMTEPQEHVNNRRLAWPRGRVLGGSSSLNAMVYIRGHAHDYDDW
ARSGATGWSYEDCLPYFKKAQAHELGEDAYRGGHGPLHVTRGTQKDQVLFKAFIDAGIDA
GYPFTDDMNGFQQEGFGWMDSTIYKGNRWSASAAYLHPIVRERSSLHIITEALVHRVLLN
GTSATGVEVSDASGNLTTYTAEKEVILCGGAINSPQTLLLSGIGPADALRAHDIPVVANI
ASVGQHMEDHLDMYVQFQCTKPITLHNASWKYPHNMVAIALQWLFQRSGQGASAHLESGG
FIRSRPGLRQPDLQYHFLPGALTGQLTPGPVHAMQAHCSPMRATSRGELTLQSRDPRQPP
RIDPRYLSTREDVDDIRNAVLLTQELFQQKAMDPFRGEPLSPNRLFGDSEHAAIDAWVRN
HTESAYHPSCTNRMGTDTRTTVVDPQCRVHGLQNLRIVDASIMPNIVSGNLNAPTIMIAE
KAADIILGRPPLPKAKGIPVYEAPRWATHQR

Enzyme Prediction     

No EC number prediction in SDRG_01491-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	17	547	2.5e-160	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	15	571	5	555	choline dehydrogenase; Validated
225186	BetA	3.81e-171	16	552	8	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.04e-87	16	547	1	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.50e-54	85	312	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.24e-43	404	542	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	2.04e-272	17	571	29	581
CAB3230510.1|AA3_2	2.04e-208	18	552	27	561
AWP09430.1|AA3_2	3.21e-206	17	562	21	565
ANI26486.1|AA3_2	2.42e-203	17	570	72	624
CAG5089487.1|AA3_2	9.18e-169	1	552	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	1.40e-76	17	549	9	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.40e-76	17	549	9	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.96e-76	17	549	9	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.03e-76	17	549	25	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	2.75e-76	17	549	9	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	1.02e-205	8	562	33	588	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.78e-203	17	571	42	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	5.57e-201	18	562	48	591	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q48CM7|BETA_PSE14	2.01e-175	14	555	5	544	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
sp|Q4ZM63|BETA_PSEU2	1.14e-174	14	555	5	544	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000007

TMHMM  Annotations     

There is no transmembrane helices in SDRG_01491-t26_1-p1.