CAZyme Information: SDRG_00839-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_00839-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		50754.17	10.0122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767133:683280-685080(-)

Full Sequence      

MRPATQRVVYIIAGEASGDAIGAKLIRALQTKEPSVTFRGVGGPQMTKQGRFASLFPMKE
LSFMGLTEVLPKLWSTLGHLHAVAKDIHACAPDAVVTIDSKGFTFRVLRTLSAQGLLYHV
LRVVDKLDVASVRRKAAVVHYVAPSTWAYNHKFKHMEATATGLSRLMDHMLVLLPFEALL
FQPRAEARPVVTFVGHPALEDFGDVHRLFETALPTHDASSVELLPPSPWLPYDAHAARKT
QAILATIAAERAQLKAPTWTICALVGSRENEVLQTISLVRQAIELHAQARAAPIHVVFPT
ISAVAPLVRAHLADWSIPCTVHVTDDASKKRSLFQQSHAAIAVSGTVVLEAALAGLPTVV
IYRANRVTEVLARSLARVQHVSLPNIMSSRTLMPEVLFSECTPINIAAALTRLCAKPPNA
VPLSQVFGSLLRWDVDPHVRPCRASEVAATVVLAEMDRKRDAVTGR

Enzyme Prediction     

No EC number prediction in SDRG_00839-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	419	5.8e-86	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	2.78e-86	9	460	4	379	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	2.51e-79	9	455	4	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	3.49e-66	9	452	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
167141	lpxB	1.06e-29	10	413	230	569	lipid-A-disaccharide synthase; Reviewed
237606	PRK14089	3.04e-17	55	406	42	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ73974.1|GT19	1.65e-58	8	457	6	387
AHJ68741.1|GT19	3.42e-58	5	419	2	346
APH57271.1|GT19	9.42e-58	5	419	2	346
APH52168.1|GT19	1.32e-57	5	419	2	346
AHJ63331.1|GT19	1.32e-57	5	419	2	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.65e-32	2	453	5	378	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.89e-32	2	453	5	378	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0BS63|LPXB_GRABC	2.34e-58	5	419	2	346	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
sp|B6IST7|LPXB_RHOCS	8.34e-57	8	464	5	395	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
sp|Q5FUA3|LPXB_GLUOX	9.66e-54	3	431	25	383	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
sp|F4IF99|LPXB_ARATH	5.68e-48	9	413	42	402	Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXB PE=2 SV=1
sp|Q3SRI5|LPXB_NITWN	7.60e-48	7	460	11	393	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SDRG_00839-t26_1-p1.