CAZyme Information: SDRG_00524-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_00524-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	JH767132|CGC8	53811.25	7.0746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767132:1583342-1584870(+)

Full Sequence      

MKLLHLLSVVAVLWPVTEAGPELSVRDHNKNKTASKRPTIRVPLDPSTQHTPVDPALAHL
RPPAPRFPAEYDMFVGLSAFRDGARCGYTVFTGFSRATRPDKLYFGIVDQLLEADLSCID
AYCALAAEAWPKWPCKYRDQIRIDSRDAAASRGPTYARHFQQDLVRDEEFCLQLDAHSEF
TTQWDTLLVQEWQRTENEMAVLTTYLHNIDSHILSDGTNLGARTAPHICQTTRGGSGNVR
NVAADLIYDSERPQLGALWGAGLSFSKCHAEKRVLIDSHTLWMFDGEEFLRASHLWTHGY
DLYSPSTRGLVVYHNYTSVPAKYFDLRVDMQAKHLETARANNRVKYLVGVPFVGEIDAEE
LDIYGWGTVRSFAAYLNYSGLVFEPNVPDKQSCKQLHWVPYEDASAIEALLPGWTPATVA
PPTAAMRKPASMRRQKGVLPSVAARQNESSALPAMCFLALILAVFVALLAWPRTHLQKTQ

Enzyme Prediction     

No EC number prediction in SDRG_00524-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	73	383	5.3e-57	0.990909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	3.07e-42	72	384	1	350	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22573.1|GT60	7.52e-156	42	478	41	502
QVE55543.1|GT60	3.72e-150	42	413	38	409
UIZ25301.1|GT60	7.59e-148	42	415	19	396
UIZ25379.1|GT60	8.06e-130	3	414	1	417
CCA18910.1|GT60	4.45e-44	77	401	91	412

PDB Hits     

SDRG_00524-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	4.92e-13	70	306	3	241	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999748	CS pos: 19-20. Pr: 0.9806

TMHMM  Annotations     

Start	End
449	471