CAZyme Information: SDRG_00446-t26_2-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_00446-t26_2-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		96773.94	6.3047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767132:1383435-1386466(+)

Full Sequence      

MRVATVVGLLGTWLAVGVAARQEARCTLQYGQTSATCELAHFGGFLASPAVILDAIVVAD
PLHACAPLTMAVPPSTLVLVARGECAFTDKLRHVAAAGSTCMAVMNHNDEVFPMASTEIA
NQSVLAVVLGRSDSVALRTAMATNAHLPASFRTSTHWLQQCSSRLEALLSTNVPRAAATT
FTACARLLDADNSVDSAVHAAFYIDAMTRFASDAHRAWDALQFAAVHSAVAVAAVAPSAN
HWLVAAEQLQLWGRLDDAAMYYTHALGLDLSPTQHTRAVCGAGLTAFLRAEIVEAKALYD
ACETVASHAFPTLFAVAVDSFRSLFSKRDVDALLEVLRGQNASLLCRHQVENGRVTLQFA
SPIVRYYYETCTQMGVFLDELGAFEASLAHFQRGLALCGKASGLHVRLALAIPSVFDSLP
AMEAYMKALSTRVDALTNDDLAPDVQSALRPDDAGYLAWTITPPTMLLGYQVRQALWRVL
LGHFLQGLPTADVQARIVAMYERLYPAALSSATEVASLHVATKRRVAFVSSWFRSHSVGK
LLRGILEHLDRATLEVAVYTSSHFFPISTTDTITAAIMDAVDRFVVLPHDAVEALALLRA
DAIDVVVFPELGMDAWTSFLAHHRFGRVQCVFWGHPITTGLVDSIDYFLGSDLYWDDDDD
EQADAAYYTEQRVRFSSLSTYFYQPEPVALHVTARDHFHLPPSSHVYLCPQTLMKLHPAL
DVIFRDILTSDPNGLVVLLYSPRQIVWKHRVRDRLAQFAPAVHDRILFLETQPYDKFLSL
LATSDVLLDPFPFGGGVTTLDALVVGLPVVTLPAKQTVVTLAAGFCRRLNLSTCIVQDEA
AFVATAVALACDKALQASVRQEIRDAHRALYHDKAAVDEWSAFLRTV

Enzyme Prediction     

No EC number prediction in SDRG_00446-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	192	878	9.9e-69	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	2.61e-42	523	864	259	589	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
239047	PA_GO-like	4.23e-13	40	145	24	133	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
239038	PA_C_RZF_like	1.83e-07	39	144	28	140	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
239041	PA_EDEM3_like	1.09e-06	40	109	5	75	PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins. This group contains various PA domain-containing proteins similar to mouse EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein). EDEM3 contains a region, similar to Class I alpha-mannosidases (gylcosyl hydrolase family 47), N-terminal to the PA domain. EDEM3 accelerates glycoprotein ERAD (ER-associated degradation). In transfected mammalian cells, overexpression of EDEM3 enhances the mannose trimming from the N-glycans, of a model misfolded protein [alpha1-antitrypsin null (Hong Kong)] as well as, from total glycoproteins. Mannose trimming appears to be involved in the selection of ERAD substrates. EDEM3 has a different specificity of trimming than ER alpha-mannosidase 1. The significance of the PA domain to EDEM3 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
238300	PA	1.47e-06	45	151	13	126	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55953.1|GT41	5.15e-266	3	887	5	874
QDU00599.1|GT41	4.02e-62	367	886	444	920
QDT82656.1|GT41	4.02e-62	367	886	444	920
QDT18528.1|GT41	5.38e-62	367	886	444	920
QDU81044.1|GT41	1.78e-61	525	887	674	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	5.23e-15	525	887	207	559	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	6.91e-15	525	887	207	559	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
5DJS_A	4.37e-14	525	864	164	490	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RVB2|SPY_SOLLC	1.02e-09	526	865	490	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|O82422|SPY_HORVU	6.95e-09	526	865	476	807	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1
sp|Q96301|SPY_ARATH	9.02e-09	526	865	485	816	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
sp|Q6YZI0|SPY_ORYSJ	1.56e-08	526	864	476	806	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
sp|O82039|SPY_PETHY	6.13e-08	526	865	490	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000545	0.999415	CS pos: 20-21. Pr: 0.9418

TMHMM  Annotations     

There is no transmembrane helices in SDRG_00446-t26_2-p1.