CAZyme Information: SDRG_00236-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_00236-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		64981.48	5.4218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767132:750948-752726(+)

Full Sequence      

MRLVYLLAALATCAVADDRDELLDRMNVWKQSGAGLEALRRNLSSPLESTNIDAELAAFN
ATLQTVAELNKLHPLARFSENNPFALMTQDEFEAYVAGNKPARNETWTQTEDATVLPAST
ATTSVDWSTSGCVAPVRNQGVCGSCFAYAAVAAAESAYCLVNNRQLTLFSDQQALSCGPG
NGCYGGWSDLSLGWMAANGVCTLDAYPNSNEWTMTTAACAKNCAPIRMPFTTVASTVGEL
ELEQALNIQPVAVDIGSSSPVFKNYAGGIITGGCDTWFDHVLLGVGYGNDGGVPFFKMKN
SWGKWWGEDGYVRLQRGVGGIGTCGLARHAAYPIVFKPQVNLVTATGNVISEYYSNLYAG
PSRGPSPNVEWSYDISTHQIKVNSNHECLDAYVDGSAYKVHTYKCDASNGNQRWRIDSAS
HRIQHMTHANLCLDVDPSQNNKVQVWACGNPAPNQWLAVSEEIVKLYSFNNRFLSSNGEM
IQFPPEGSYPYEWVVNNVDNTWRARSNTGDPQRCLDAYQPWNGGVVHLYACDATNANQKW
RYDASTQQLRHVTHVGFCLDMRTAEGSQAHLWRCNAPTNDLQRFTYVSQSFP

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239068	Peptidase_C1A	2.79e-48	123	333	2	210	Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues.
395062	Peptidase_C1	9.89e-44	123	334	3	212	Papain family cysteine protease.
214761	Pept_C1	6.45e-33	123	333	3	175	Papain family cysteine protease.
185513	PTZ00203	2.45e-27	56	318	59	326	cathepsin L protease; Provisional
240310	PTZ00200	3.03e-24	126	326	239	436	cysteine proteinase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55540.1|CBM13	3.13e-284	3	592	6	599
AIG56318.1|CBM13	8.36e-190	5	569	4	558
AIG56282.1|CBM13	4.95e-174	14	566	20	559
AIG55595.1|CBM13|GH17	4.19e-53	333	587	296	559
AIG56230.1|CBM13|GH17	1.04e-50	276	587	177	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P5W_A	8.29e-37	125	336	5	218	Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta]
3P5U_A	2.05e-35	125	336	5	218	Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta],3P5V_A Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta],3P5X_A Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta]
1AEC_A	2.68e-35	125	336	5	218	CRYSTAL STRUCTURE OF ACTINIDIN-E-64 COMPLEX+ [Actinidia chinensis]
3IOQ_A	3.22e-35	123	333	3	209	Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64. [Vasconcellea cundinamarcensis]
4YYQ_A	9.37e-35	124	334	4	215	Ficin A [Ficus carica],4YYQ_B Ficin A [Ficus carica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5HII1|ACTN_ACTDE	1.06e-35	82	339	89	347	Actinidain OS=Actinidia deliciosa OX=3627 PE=1 SV=1
sp|P25251|CYSP4_BRANA	2.40e-35	84	349	58	328	Cysteine proteinase COT44 (Fragment) OS=Brassica napus OX=3708 PE=2 SV=1
sp|Q94B08|RDL1_ARATH	4.75e-35	84	351	103	374	Germination-specific cysteine protease 1 OS=Arabidopsis thaliana OX=3702 GN=GCP1 PE=2 SV=2
sp|P43156|CYSP_HEMSP	2.29e-34	59	334	63	345	Thiol protease SEN102 OS=Hemerocallis sp. OX=29711 GN=SEN102 PE=2 SV=1
sp|P80884|ANAN_ANACO	2.31e-34	82	343	84	345	Ananain OS=Ananas comosus OX=4615 GN=AN1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999735	CS pos: 16-17. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in SDRG_00236-t26_1-p1.