CAZyme Information: SAPIO_CDS9803-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9803-t41_1-p1
• CAZy Family: GT4
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	JOWA01000143|CGC2	61117.13	4.7430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000143:1803358-1805181(-)

Full Sequence      

MESTIYDVIIVGGGTAGCILAARLSEDPGLEVLVIEAGADQLADPRVNVPALWHTLLNGP
ADWTFRTTPQKYLEGRERPIPQGKLLGGSSAMNGLIFTPTPKSNVHAWTQLGNPGWEWPS
FSQSLGKVYSLAGRPNNGPLQLSFPDNSDNEWPQVWKDTLAGLDIPVTGDLLTGEANGLI
VNPETVDPETKTRSHAGSVYLGPALSRGNLTVVTEATVEKILFDKSNPAEVLAEGVQYTK
AGETKVVRARKEVVLAAGAINSPKVLELSGIGDAGLLEKLGIDVVINNPNVGENLQDPVM
CILSFEAKDGIKTLDPVARQEPEAVAAAQEAYARLTGPLATSGTSNTAQLPFPGIETDEG
KRELDRLLDTLLNTKVDEDKPALLAAEANKNFVRSILASPEEASGCYITLPGYVGFDAAG
AMVPPPPGKEGYFSIALLTTHPLSRGSTHIKSASAAVQDVDLDPHYFSHPLDLEIFARHL
RHLETVLVASSPLSDRLKPGGKRNPEAPSPGGFSDLDKAREYARSTAMDAHHFVGTCSMM
LPELGGVVDPQLRVYGTKNLRVCDASIISSDPAS

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9803-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	570	5.8e-148	0.9524647887323944

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.25e-78	1	567	1	507	choline dehydrogenase; Validated
225186	BetA	6.56e-78	6	570	8	512	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	7.56e-25	6	574	56	559	Protein HOTHEAD
398739	GMC_oxred_C	1.37e-24	442	568	1	124	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.25e-23	75	297	16	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS99722.1|AA3_2	2.69e-221	6	572	4	572
UKZ52598.1|AA3_2	1.16e-219	6	572	4	570
UKZ90567.1|AA3_2	5.22e-209	6	572	4	573
AEO71939.1|AA3_2	2.39e-160	2	574	4	583
ANH22750.1|AA3_2	8.16e-158	1	568	39	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.99e-64	1	568	1	541	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	1.01e-49	6	568	17	564	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6O9N_A	7.19e-48	6	574	36	621	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	3.83e-45	6	566	6	557	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.32e-44	6	572	2	542	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	9.11e-80	4	568	12	585	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	9.11e-80	4	568	12	585	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.42e-76	1	568	9	593	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.97e-76	2	567	36	605	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	8.78e-68	1	567	42	591	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997993	0.002047

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9803-t41_1-p1.