CAZyme Information: SAPIO_CDS9741-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9741-t41_1-p1
• CAZy Family: GT39
• CAZyme Description: Glucose oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	JOWA01000143|CGC2	68512.44	4.5633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000143:1624686-1626741(-)

Full Sequence      

MRNLKSSVLVFLTATAKLIAAWPVVSEHAQLLTRAEEVADEYDYVIVGGGTSGLTVGDRL
TENGKYTVLVIEEGVFHEKTGFDFQRMYDITSQPSPGLNDRTFLVGIGKGVGGSSLVNGQ
VFLRGTSEEYDAWKTLGGSDAADWDWNGLLPFFRKAMTLNPPTEDQVEKFKILYDLDYWG
TDAEIQVSFSNGNASDQTMILYDAMSKVPGVNIPVDSGAGEAGLYWYPMAQDNVNFQRSY
ARTGHWDGLQRDNYQMIVGAKVSTILFDDSNDVLTASAVTFRSGNDTSAEPITVKAKREV
ILAAGAIHTPQILMLSGIGPASHLAEAGIETKLDLPGVGANFQDHSYIPIIAYEWGKAPT
NETPVYGPGVGPGAYPNLAAMLGLPVVAPEAYEALAAEYAAQDPAEFLPADYTPEQIEGY
RQQQKVFSELVRSPNVVFSEMMLSGPGGSVQNLHPFSRGHVRLNASHPEAEVLVDYRAGS
NPLDLRVMVEIVKFMRRFMTTGELAQYEAVESSPGPEVETDEQLLAWVKDNVIPSVFHPI
GTTAKMPQEWGGVVDEDLFVYGTKKLRIIDSGIQPTLIGATTCETVYAVAEKIAEIILAQ
AGGEEPEPEPPLCKRGLKRARKAQKSKKK

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9741-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	599	2.8e-141	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.86e-88	41	598	5	532	choline dehydrogenase; Validated
225186	BetA	2.25e-76	37	602	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.77e-37	43	598	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.67e-29	455	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.39e-26	99	345	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71339.1|AA3_2	2.90e-161	36	593	21	582
CDP22349.1|AA3_2	1.00e-156	36	593	21	573
VBB78527.1|AA3_2	1.31e-153	26	601	19	617
VBB80399.1|AA3_2	8.24e-143	29	597	26	627
CDP28753.1|AA3_2	1.19e-141	29	596	26	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	3.53e-98	11	600	3	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	2.08e-78	38	597	2	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.49e-58	42	601	6	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	1.34e-54	42	599	17	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NIT_A	5.01e-52	28	598	3	574	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.85e-90	25	602	21	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	5.44e-61	42	598	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.44e-61	42	598	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.23e-55	43	597	41	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P13006|GOX_ASPNG	3.80e-51	28	598	27	598	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.150303	0.849685	CS pos: 21-22. Pr: 0.7819

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9741-t41_1-p1.