CAZyme Information: SAPIO_CDS9407-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9407-t41_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656		71106.63	4.2684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000143:409089-411691(-)

Full Sequence      

MPSLRAWRRALAPVAILSWASLVVAHPLVSDKLLRRAEIQIEDVKESYDYIIVGGGQAGI
VLASRLSEDPDVTVLVVEYGYFNNAPSVLQPSSATSYQRNVQFNITSVPQTELDGYKQSV
FAACCVGGGSTINGMLLNRGSAADYDAWEALGNPGWGWEGLYPYFIKSQTLDEPNPASAE
EFNITWGPESYGDGPIHVSFSSFQWPGVKIQRQALIEAGAEAPIDGSGGDAYGVIWYPTA
LDNSTATRSYAVNGYWDPAKDRPGLNLLTGWRVDEVTFDEDKHATGIVMRQRGVEDAERI
SVKSNREIVLAAGALHSPQVLQRSGIGPKWLLDEAGIDVLVDLPGVGSNLQDHAVSGVSY
QFTTNLELNPQDSMANTTFAQWAAKELAENHAGPLRIATGNIGGLIPFPVIDPEGYEALI
EEYLDLDLAPHLPSSYTEENIAGYDAQRTVMADMLGRADNAFLELPLQAAPGYSAVLIKV
LSRGTVHLNPEDIYGEPIVDYFTYGMPIDKRIMRRVVKWVRKVHATDAMSELGPKEVSPG
EDVVTDEEIDAWLTKSTSCSTAHNSCSNPMMAREHGGVVGPDLLVHGVTGLSVADSSIMP
IVPGAHICSTVYAIAEKAADIIKERHGGKAEKPEEPEEEVPEEGEPIEEDPEDDSC

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9407-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	47	624	2.1e-160	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.25e-96	46	625	4	534	choline dehydrogenase; Validated
225186	BetA	3.28e-81	43	627	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.47e-29	482	618	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.54e-28	126	355	27	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.17e-15	46	630	54	585	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43942.1|AA3_2|CBM1	2.79e-192	16	627	14	623
QRD00954.1|AA3_2	1.20e-154	47	625	24	604
SMY23609.1|AA3_2	3.60e-142	43	626	39	622
SMR50915.1|AA3_2	3.60e-142	43	626	39	622
SMR51855.1|AA3_2	3.60e-142	43	626	39	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.31e-116	20	622	6	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.44e-106	43	626	1	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.99e-66	47	624	5	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	1.19e-58	48	622	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	3.19e-53	41	628	6	532	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.22e-111	16	627	7	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.06e-70	47	623	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.42e-69	16	622	4	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.42e-69	16	622	4	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.47e-63	41	627	7	613	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.099576	0.900382	CS pos: 25-26. Pr: 0.8624

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9407-t41_1-p1.