CAZyme Information: SAPIO_CDS9253-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9253-t41_1-p1
• CAZy Family: GT31
• CAZyme Description: Beta-apiosyl-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1037	JOWA01000132|CGC2	116929.42	5.7320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:1905539-1909349(+)

Full Sequence      

MAIKSTLLSCGLLLLQATIPSLLPGVSAQSDQILLGQEGSTFGPSGKGPNIVFILTDDQD
LHMDSLDYLPLIKKHLTDQGTLFKKHFCTTAICCPARVTLWTGKLAHNTNVTDVSPPHGG
FPKFVAQGLNDHYLPTFLQDQGYATYYTGKLFNAHDVNNYNNPYPAAWTGSDFLLDPFTY
MYLNATFQRNQDPPVSYEGQYSTDVLAGKALGFLDEAVAGGKPFFLGIAPVAPHSNVNLG
KLVNENDSFSLPIDQPDVSAYFSPPIPAERHAHLFPDAVVPRRANFNPDFPSGANWIYQQ
PKQSPENVAFNDHYYRSRLRALQAVDELVDSVVEKLDAHGILDDTYIFYTTDNGFHIGYH
RLQPGKECGFEEDINIPLIVRGPGVPKGQVSEIVTQHADLTPTIVKLAQGPSRADFDGIP
IPLTEEGLTDAAKTRHDHIGVEFWGIAAAEGKFGFFGRNQSLVLNNTYKAIRIVSEEYNL
YYSVWCTNEHELYDLNTDPEQIQNLLRPDSKVTTLLGLPIGKIVARLDSLLLVTKSCKGI
TCSKPWDALHPQGNVASLWDALSPRFDTFYEKQQAKVSYSRFQIEGAWNQGGKGQSIWDT
FCHSPGRIKDNSTADDACLSYQLHEQDIARMKEYGVTAYRFSLSWSRIIPLGGKDDPVNE
EGIAFYNTLIDTLLRNGITPFVTLFHWDLPSSLYERYRGMLDQAQYAPDFVRYAQVCFER
FGDRVKHWITYNEPALVARAGHGEGRHAPGHISPTEPFIVAHTQLVSHGHVCAMYKREFQ
PTQNGHIMITLDGGWSEPWDADDPRDVEAAQRATEFEIAWFADPLFGSGECDYPASMRAQ
LGDCLPHFTPEEKILVRGSSEFYGMNSYTSYFVKHRNESPEEGDFRGNVIRLDQNKAGVE
RGIESDTPWLRTAPWGWANLLRWIWNRYHVPIYITENGTTAKGELEFRPRSPDDILEDPH
RIEFYRSYLAEVAKACQEGIIIKSYFAWSLLDNWEWALGYTARFGVTWVDFDSPEKTRHA
KRSAYFLKDFFQHLKRS

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	577	1033	1.1e-140	0.9627039627039627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
293766	G6S	0.0	49	506	2	393	glucosamine (N-acetyl)-6-sulfatase(G6S, GNS) AND sulfatase 1(SULF1). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficient of N-acetylglucosamine-6-sulfatase results in disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease. SULF1 encodes an extracellular heparan sulfate endosulfatase, that removes 6-O-sulfate groups from heparan sulfate chains of heparan sulfate proteoglycans (HSPGs).
395176	Glyco_hydro_1	3.84e-141	577	1030	13	447	Glycosyl hydrolase family 1.
225343	BglB	6.72e-120	577	1029	12	448	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	4.87e-90	580	1031	39	480	beta-glucosidase
215455	PLN02849	1.06e-87	580	1032	41	481	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANA91018.1|GH1	2.45e-248	583	1034	30	493
UPK96098.1|GH1	1.54e-237	583	1034	29	488
QKD53715.1|GH1	5.10e-230	583	1034	28	487
UQC79081.1|GH1	2.69e-229	583	1034	632	1091
CEI59997.1|GH1	8.48e-229	583	1034	29	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBK_A	2.24e-149	582	1034	16	462	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	4.24e-149	582	1034	35	481	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
6EFU_A	4.43e-149	582	1034	16	462	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
4MDO_A	2.05e-147	582	1034	39	495	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
3AHY_A	2.39e-147	582	1034	22	469	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	5.81e-137	582	1031	24	471	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.60e-134	582	1032	19	457	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	1.03e-124	577	1032	29	480	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	1.47e-117	582	1028	63	516	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q75I93|BGL07_ORYSJ	6.86e-116	580	1033	54	504	Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999761	CS pos: 28-29. Pr: 0.9720

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9253-t41_1-p1.