CAZyme Information: SAPIO_CDS9159-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9159-t41_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
910	JOWA01000132|CGC10	101798.47	9.3446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

Full Sequence      

MDLKEEPQGSHNDSIREESEGTSSIDPALEASIRKKLDMRLMPILTLVYLFAFIDRSNAG
NARVLGMGEDLKLDGYRFNIALSAFYVPYILFEVPANVMCKIAGPKIWIPTLAILFGLVV
TCMSTLKSYEGFIVARVFLGFAEAGIMPGISYTLACFYRRRELVTRVGLYASVASLSGAF
GGLLATAFTKIPSWGIIHTWRNIFFFEGIISIILGIVAFFILPSSPATASFLTPEECKVA
VSRIADDLKTEQIETIKKEYFKRAIWNPNTILLAVAMLCSLTSMNSMALFVPSILNAMGY
SGIHSQLLSVPPYAWATIVCISVSTLSDRTCKRGKWILTVMPFTVAGFIVLLTPAKVAVH
YFALFLCLTGVFTASPMLVAWSIDNSAGHLTRAIVSGFSPESGSAVPATSTFSPAPSHFN
SHHFLASAFDSFDDQRRLIALCLTMMFSKQIITAQTIHSTTTERHRSQLPVMAPHLQRHA
NLNQPGPRRFYFSSLRRHRRRIVAVVIVVAIYYFFRFTPAPPRSIANSNGGRPTRTTPDR
DLDPQPHFIYRSSFRMNPNSAYEADVDAALVSLEHRVTRGEVDDGQNVSQKRPRKLWQIL
LGPAERGPDSWAFEEKNRAWEYTVVRDEWANSFVNDTFGAIPGLVDLYKSYPYDVLRADL
LRYLILWFYGGYYADTDINPARAIDSCPPLAPVLPTNQDIHNANISLVIGIEIDEPWASA
KLMREWHWIRTYGFVQYNLYAPQRFSPLLRRAIVRVLAHTKRHKDASWLTGPIYNEKTIL
EITGPGVFTDAVLDVLSETLPITHPLVQASVAADAEVGDLAVPVGAESKRERVTWAPFHR
LREPLWIDATEAAAGKSMGGLGVLPISVWGNGQRHSGSESFRSPHACINHRFKGTWKKGW
WQRWFGKQNR

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9159-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340885	MFS_FEN2_like	7.70e-102	36	397	1	362	Pantothenate transporter FEN2 and similar transporters of the Major Facilitator Superfamily. This family is composed of Saccharomyces cerevisiae pantothenate transporter FEN2 (or fenpropimorph resistance protein 2) and similar proteins from fungi and bacteria including fungal vitamin H transporter, allantoate permease, and high-affinity nicotinic acid transporter, as well as Pseudomonas putida phthalate transporter and nicotinate degradation protein T (nicT). These proteins are involved in the uptake into the cell of specific substrates such as pathothenate, biotin, allantoate, and nicotinic acid, among others. The FEN2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340877	MFS_ExuT_GudP_like	9.67e-40	40	383	3	295	Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
369468	MFS_1	1.26e-31	45	398	1	333	Major Facilitator Superfamily.
349949	MFS	2.73e-20	45	398	1	333	Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.
225180	UhpC	2.21e-14	35	276	24	260	Sugar phosphate permease [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21634.1|GT32	BCS21634.1|GT32	2.39e-142	538	906	49	414
CAP98643.1|GT32	CAP98643.1|GT32	4.94e-137	519	906	37	421
BCR86108.1|GT32	BCR86108.1|GT32	6.29e-137	533	906	54	418
QMW37982.1|GT32	QMW37982.1|GT32	1.05e-136	535	906	48	413
UCK58385.1|GT32	UCK58385.1|GT32	1.05e-136	535	906	48	413

PDB Hits     

SAPIO_CDS9159-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6J0|YHDC_SCHPO	sp|Q9P6J0|YHDC_SCHPO	5.51e-59	19	397	19	401	Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.12 PE=3 SV=1
sp|A0A2Z4HQ22|EFUF_HORCR	sp|A0A2Z4HQ22|EFUF_HORCR	3.12e-57	26	398	36	410	MFS-type transporter efuF OS=Hormonema carpetanum OX=284138 GN=efuF PE=3 SV=1
sp|Q9US37|YFZ4_SCHPO	sp|Q9US37|YFZ4_SCHPO	2.49e-55	25	394	45	416	Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.04 PE=3 SV=1
sp|Q9US44|YIZG_SCHPO	sp|Q9US44|YIZG_SCHPO	2.87e-55	32	393	50	412	Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1002.16c PE=3 SV=1
sp|A0A0A2IBP6|CNSO_PENEN	sp|A0A0A2IBP6|CNSO_PENEN	8.50e-53	28	397	47	428	MFS-type transporter cnsO OS=Penicillium expansum OX=27334 GN=cnsO PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000019

TMHMM  Annotations     

Start	End
37	54
75	92
107	126
166	188
203	222
265	287
302	324
336	355
361	383
502	520