CAZyme Information: SAPIO_CDS9121-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9121-t41_1-p1
• CAZy Family: GT3
• CAZyme Description: Glucose sorbosone dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		49219.87	4.5330

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:1429116-1430676(+)

Full Sequence      

MMLKHTALAAALFAAGALAKCENVIVPSYQSPTLASGWQGQLVANGFKKPRTLHFDTEGS
LIILDAGVGVRRVKFTDNGDTCLEVAENKLLIDNKDLNHGLAFSGDGKTLYASTEESVFA
YTYDAKAGTVADASSPRTVIDGMSSNDHLTRTLLMSQKSPGFLAVSRGSDENFDVDAEDP
TTGVSQIKIFDLNKLASGAKYTFNSDGRRLGWGLRNSVGIAEDPDSGRIYSVETSVDEVT
RNGQNIEKNNPGEELNMHSKATETAEGGNYGYPYCYPIWDTNVPDNEGLQTGDLFSTNET
HITDEKCAEDTVAPRLVFPAHTSPLNLLFNSDGSTLYISFRGSFDPTNPVGYMVSTVSFT
NGQPTARLSATDALTPIFTNPSLSACPANCFRPVGLAFDSQGRLWVSADSTGEIYVLKKL
ADAAAPGVFVSKPDESGAGTPGAFGLQGVLVGGAAFAVAALIAL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9121-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	22	417	4.9e-157	0.9950124688279302

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.99e-17	27	415	46	392	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
400653	SGL	1.39e-04	78	142	121	179	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.
380207	ScyE_fam	0.004	323	424	9	104	ScyD/ScyE family protein. This family includes ScyE, a protein involved in scytomenin biosynthesis and export, and its paralog ScyD. Some members of the family contain a C-terminal PEP-CTERM domain that predictions anchoring to the outer membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81439.1|AA12	7.01e-159	3	441	36	482
VBB80430.1|AA12	1.63e-141	1	440	1	450
UNI18151.1|AA12	3.67e-140	7	419	9	438
UKZ85601.1|AA12	2.44e-134	21	419	30	432
QLI68104.1|AA12	2.75e-134	21	433	32	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	3.93e-130	23	419	2	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	4.06e-130	23	419	3	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	4.20e-130	23	419	4	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	1.64e-65	21	419	5	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

SAPIO_CDS9121-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002085	0.997893	CS pos: 19-20. Pr: 0.8487

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9121-t41_1-p1.