CAZyme Information: SAPIO_CDS9092-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9092-t41_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		48574.87	9.8577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:1340436-1341970(+)

Full Sequence      

MAKSQQGTSTSDRTILLGVFVAWKAFLLAIALGSSTTPSYDTSTSLALNLPPDHVAAAAA
SSASLLPPSPSLTDIIAARLTRWDAIYFTQSANRGYVFEQEWAFGAGLPFLVSRVVLPLA
SRLGLGPHGQLTVKSAALAAIAVSHLSHLLTVFLLYSLVRRLLPGRGNLALTTSLLHVLS
PAGLFLSAPYAESLFACLSFAGYLVYVSSEGGSAVRHGLGLIISGALLGLATTCRTNGIL
NGIIFVVELLATLHVFARSPRLTNAFTVTSTIVGGVLVGLGSVAPQIVAYLRYCSEASGD
GGLKRPWCTKLVPSIYDFVQEQYWNCGFLRYWTLGNLPLFLLALPMLGLMLTSSYTTIVP
MIPSVITDLRSTTPSTRLLLSLSVGQGLLALLAFTNYHVQVITRLASAYPIWYIWVARSL
QSKSRSSPPRNIVMYMVLYASVQGVLFASFLPPA

Enzyme Prediction     

No EC number prediction in SAPIO_CDS9092-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	19	454	8.7e-109	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.32e-35	80	454	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.46e-16	82	454	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73372.1|GT76	2.30e-115	10	454	7	437
QLI68133.1|GT76	1.01e-114	16	454	13	429
QPH11053.1|GT76	8.91e-114	16	454	13	432
UKZ53459.1|GT76	3.02e-110	16	454	15	437
CCT64606.1|GT76	3.12e-110	10	454	8	427

PDB Hits     

SAPIO_CDS9092-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.41e-107	16	454	14	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	6.18e-107	16	454	22	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	8.68e-81	20	454	26	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.03e-76	19	454	36	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	4.75e-54	14	454	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.854051	0.145962

TMHMM  Annotations     

Start	End
13	35
137	159
182	204
214	231
238	257
262	284
340	362
377	399
432	451