CAZyme Information: SAPIO_CDS9079-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9079-t41_1-p1
• CAZy Family: GT24
• CAZyme Description: Xyloglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	JOWA01000132|CGC6	88630.38	5.3396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:1290823-1293495(+)

Full Sequence      

MKFLKAILAVLAATASHADAAFSWKNVRIGGGGGFVPGISFHPTTAGVAYARTDIGGLYR
LNPSDDSWTPITDSLATNDKWSYWGIDAMALDPQDADKIYALVGMYTNSWDPNNGAVIRS
SDRGNTWQTTELPFKVGGNMPGRGMGERLAVDPHDSKVIYLGARSGKGLYRSTDGGVTFA
KVSSFTAVGTYVPDPTDANGYNNDIQGLAFVTFDDTSGTASNGRTKRIFVGTADNTTASV
YVSNDAGETWDAVAGQPGTYFPHKCRLQPQEKALYLSYSDGSGPYDGTKGAVYRYDITAG
TWKDITPATGDDLYFGFGGLSVDLQKPGTVMVATLNSWWPDAQIFRTTDSGATWSKIWEW
AAYPDQNQYYSMSTPKAPWIYENFVSVDTKRLGWMIEALEINPHDSNHWLYGTGLTIYGG
HDLAKWDSGSGRNVTIQSLADGIEEFAVLEVTSVPGGSELLAAVGDDSGFTFKTKVDLGT
SPQTAWNNPMFTSSTGVDYAGNSVKSVVRVGNSAGSPQVALSNDGGATWNLNYAASNDQY
GGRVAYSANADTILWSSESSGVLRSQYQGSFTAVSSVPSGAAIASDKKDNAYFYAGTTKL
LVSSDIGATFSPGGSLGAATSIRDIAVHPTVAGELWVSTDVGIFHSTDHGATLSLISSTL
TNTHRIALGKGSGSSWILYAFGHGPVGARLYATADNGASWQDIQGSSQGFGAIDGCRLAG
SANEPGLVYVGTNGRGVLYAQGTVQGGGGNPTSSSSSSSPSSTAKTSSTTTRVSSTSSVR
TSSTLTTSTRASSSSSSAQPTATDGPTAPRWGQCGGIGWTGPTRCESPYACQKQNDWYHQ
CL

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	-	3.2.1.4:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	79	184	1.8e-23	0.43776824034334766
CBM1	811	838	1e-15	0.9310344827586207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.36e-15	809	842	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.02e-13	810	838	1	29	Fungal cellulose binding domain.
406353	Sortilin-Vps10	1.11e-10	58	266	3	211	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
214740	VPS10	9.31e-05	115	282	55	230	VPS10 domain.
406353	Sortilin-Vps10	5.26e-04	115	251	1	110	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP57752.1|CBM1|GH74|3.2.1.151	0.0	7	842	6	838
ABH71452.1|CBM1|GH74|3.2.1.151	0.0	7	842	6	838
UKZ78605.1|CBM1|GH74	0.0	7	842	333	1167
QYS99983.1|CBM1|GH74	0.0	1	842	1	840
ABJ18610.1|CBM1|GH74|3.2.1.151	0.0	21	842	1	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	5.70e-192	22	740	6	744	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6P2O_A	3.79e-190	21	657	2	641	Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491],6P2O_B Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491]
6MGJ_A	2.53e-187	22	740	6	744	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
4LGN_A	1.52e-186	22	739	7	732	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
6P2N_A	7.30e-184	21	740	5	745	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	0.0	7	842	6	838	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	1.49e-192	14	740	30	764	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|Q70DK5|XG74_ACETH	2.77e-167	9	741	16	757	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|A3DFA0|XG74_ACET2	5.50e-167	9	741	16	757	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q8J0D2|CBHRE_GEOS1	7.13e-88	7	740	16	783	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000304	0.999649	CS pos: 20-21. Pr: 0.6148

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9079-t41_1-p1.