CAZyme Information: SAPIO_CDS9070-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS9070-t41_1-p1
• CAZy Family: GT22
• CAZyme Description: Xyloglucan-specific exo-beta-1,4-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	JOWA01000132|CGC7	89998.56	4.9211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:1254678-1257879(-)

Full Sequence      

MQFTSRVATTIVTAASLWQSCQAQGPLATVYTDPETGIIFDAWSATTSQTQGGMTIGMAM
PSNALSTDATEFIGILTCSSPNGKSTGWCGISLGGTMPQNLLLMAWPYGDEVLTQFMWAS
GYDTPVPYTGNAKLTQISSAVNGTNYSVIFRCENCLAWDQDGETGGISSSSGFMLLGWAQ
AYSSPGNPSCPANIRLEQHDTQNIFPAIPDSNIANPSYSSWAALATKTVTGDCGGGPDPT
NTETPPSSTSSSVPTKTGVPVPTDTAYDYVIVGGGAGGLPMADRLSAQGKKVLLIEKGPP
STGRWGGSMKPAWLEGTSLTRFDVPGLCNQIWHDSAGIACTDTDQMAGCVLGGGTAVNAG
LWWKPYSQDWDYNFPSGWKSNDVAAATNRVFSKIPGTTVPSTDGKLYLQQGFDAVSSGLR
NAGWSEVSANQEPNRKNRTFTHTPYMFSNGERGGPLATYLVSASQRSNFKMWTGTAVKRV
IRSGGHVTGLEVEPFLSGGYTGTVPLTPVTGRVILSAGTFGSAKILLRSGIGPIDQLQVV
QNSTDGPTMISEDQWIDLPVGYNLEDHTNTDTVITHPNVEFYDFYEAWDAPITSDKNLYL
NNRAGILAQSAPNIGPVFFEEIRGNDGIVRQLQWTARVEGTFDTPDGKAITMSQYLGRGA
KSRGRMTITRNLNTAVSTVPYLRDPNDIEAVIKGIENLQAALANVPGLVWTYPPPGVTAR
QYVTDMVVSTSNRRANHWIGTCKTGQDDGRSNGSAVIDTNTRVWGTDNLFVVDASIFPGM
VTANPSAYIVVASEHAADKILALAPAGEQPRYAQCGGLTWNGSHQCAAPYTCQKTNDYYS
QCL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	258	803	4.8e-251	0.9817518248175182
AA8	31	221	1.2e-64	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	5.86e-68	31	207	1	168	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	5.89e-48	267	806	8	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	4.64e-41	30	207	1	166	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	6.00e-28	263	805	2	536	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.65e-25	661	796	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC85492.1|AA3_1|AA8|CBM1	0.0	1	842	1	841
AUS45831.1|AA3_1|AA8|CBM1	0.0	1	843	1	828
QKX62083.1|AA3_1|AA8	0.0	21	841	178	984
AOW70087.1|AA3_1|AA8|CBM1	0.0	23	843	23	840
AEO69014.1|AA3_1|AA8|CBM1|1.1.99.18	0.0	1	843	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	31	843	8	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	0.0	31	843	7	806	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	8.83e-292	265	843	6	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.72e-124	265	804	1	538	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	2.01e-124	265	804	6	543	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	8.86e-152	28	804	21	770	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|B3PTE0|BETA_RHIE6	2.68e-22	268	810	4	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	5.64e-22	265	800	3	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A6U6Y8|BETA_SINMW	8.34e-22	268	810	4	530	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1
sp|Q1MJU4|BETA_RHIL3	2.60e-21	268	810	4	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000933	0.999058	CS pos: 20-21. Pr: 0.9140

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS9070-t41_1-p1.