CAZyme Information: SAPIO_CDS8939-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8939-t41_1-p1
• CAZy Family: GT21
• CAZyme Description: Glycogen [starch] synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		84802.97	6.5388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000132:732113-734591(-)

Full Sequence      

MSSPTHQNSVRGDTTRDMLNHLLFEVSTEVANRVGGIYSVIKSKAPVTTLEYGDRYTLIG
PLNKRSAAVEVEEIEPTNPEIKATLDSMRERGVHLVYGRWLVEGAPRVILIDTSTGYQWL
NEWKSDLWNSAGIPSPPDDHETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVA
LPLCKKRKIDVTTVFTTHATILGRYLCAGSADFYNHLQWFDVDHEAGKRGIYHRYCIERA
SAHSCDVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFAAAHEFQNLHQASKEKIHDF
VRGHFYGHLDFDLDNTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKSAGSTVTVVAFII
MPAQTTHLTAESLKGQAVIKSLRDAVSVIERNIGKRLYERALRWQEGDSLPEEKDLLSNQ
EKVDLRRRLYSMKRHNLPPIVTHNMVNDHEDPILNQLRRVRLFNDRSDRVKVVFHPEFLN
SSNPVLPLDYDEFVRGTHMGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELLD
CGPEYGIFIVDRRMKGVDDSVNQMTDFMFEYCLKTRRERINQRNRTERLSDLLDWRRMGL
EYSKARQLALRRAYPDEFPEDDTLWDWVPGVKQKIGRPFSVPGSPGARKGTMTPGDFASL
QEGKEGLSTEDYIAWKLQYEVPPPKEASLVKADPLFVPPNSLTNTLSRDDHEDDYEWSVA
VRPKPSGPASPIDTPKAVDAENGE

Enzyme Prediction     

EC	2.4.1.11:48

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	25	662	6.8e-296	0.9984301412872841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340824	GT3_GSY2-like	0.0	20	612	1	590	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
399009	Glycogen_syn	0.0	25	669	1	639	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
340831	GT4_PimA-like	4.63e-07	450	604	232	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340816	Glycosyltransferase_GTB-type	8.43e-06	423	531	125	222	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
223515	RfaB	6.59e-04	133	350	55	232	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC74116.1|GT3	0.0	12	683	5	676
QPC65232.1|GT3	0.0	12	683	5	676
CZS72551.1|GT3	0.0	12	683	5	676
CEF84662.1|GT3	0.0	12	683	5	676
QKD51170.1|GT3	0.0	15	683	8	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KQM_A	7.75e-308	11	674	17	705	Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_B Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_C Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_D Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO]
6U77_A	4.51e-307	15	674	2	686	yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	7.75e-307	15	674	22	706	Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
5SUK_A	9.27e-307	15	674	22	706	G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_B G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_C G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_D G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C]
4KQ1_A	1.80e-306	11	674	17	705	Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93869|GYS_NEUCR	0.0	16	683	9	675	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
sp|P23337|GYS1_YEAST	2.48e-316	16	673	3	684	Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY1 PE=1 SV=3
sp|P27472|GYS2_YEAST	1.64e-306	15	674	2	686	Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY2 PE=1 SV=3
sp|P13834|GYS1_RABIT	4.36e-267	17	671	23	671	Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4
sp|A2RRU1|GYS1_RAT	3.92e-266	17	671	23	671	Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8939-t41_1-p1.