CAZyme Information: SAPIO_CDS8747-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8747-t41_1-p1
• CAZy Family: GT62
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		44105.51	5.3439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000127:27965-29293(-)

Full Sequence      

MHAARLHLVLLGLLSGPGLDLVSAARRPVIARRGVECYFDIQAESGETCQGMASSWGISV
DEFTKINPGVTCPNLEAGKSYCVVGEYTDDGGSETTPPVPPTTTSTTTTAPPTTIRTSIT
TSTTTAPAPSNSPAMPGIVDNCDSFYKVQLGDQCDSIAQKHGISVAQFKAWNTEINASCS
NLWADYYVCVRVPGATTPPTTTTTTTTGPAPSNSPLMPGVVANCNRFYKVQSGDGCEIVA
QKNGITTAQLRSWNTEINASCTNLWTDYYICTGVPGAVTNPPTTTTSAPSPSNSPALPGA
VSNCNKWYKIVSGDTCDNIAAKNTITVAQLRSFNTQINSSCNNLWVDYYACVGTPNAATP
MPGIVSNCSRYYLVVSGDSCDVIASKAGITVADFRKWNTSINSACTNLWLDALVCTKA

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	3.46e-18	146	398	333	576	1,4-beta-N-acetylmuramoylhydrolase.
180536	PRK06347	5.35e-13	226	398	331	508	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	2.36e-10	145	188	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.36e-09	226	270	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	4.15e-09	370	409	1	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16287.1|CBM50	7.60e-104	30	353	19	338
BCS04718.1|CBM50	7.60e-104	30	353	19	338
BCS23655.1|CBM50	5.59e-98	30	352	19	330
QQK44150.1|CBM50	5.17e-80	32	415	28	423
UNI17016.1|CBM50	1.02e-77	31	353	25	324

PDB Hits     

SAPIO_CDS8747-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	2.40e-63	67	415	98	454	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	6.19e-17	37	194	29	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	9.98e-15	126	274	251	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	4.68e-12	117	353	237	535	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|P37710|ALYS_ENTFA	7.62e-12	143	398	360	593	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999754	CS pos: 24-25. Pr: 0.9648

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8747-t41_1-p1.