CAZyme Information: SAPIO_CDS8610-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8610-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: Glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37501.64	7.5055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000121:1989678-1990736(+)

Full Sequence      

MISKSPEEIANGHARNGEKRTGKVWATLITHESYLPGLLTLNYSLRKAHSTFPLIALYTD
SLPEWCLAAIQARDIATRRVEYIQPSSGRNYSEDPRFIDTWTKLAVFSLTEYKRVVLLDS
DMLVLRNMDELMDLDLDEPGVAARGGAGSRRVYAAGHACVCNPLKKKHYPADWVPENCAF
TKQHRSPDKAQVSGGGCDLSPLGNINSGLIVINPSEEIFAQIVEYMEKHASRMLFPDQSV
LSELFQGRWVALPYIYNALKTLRKPETHQAIWRKDRIKNVHYILAPKPWDELDRHGRWTG
TEESHKWWIDTNRERQEVERREAIADGF

Enzyme Prediction     

No EC number prediction in SAPIO_CDS8610-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	13	292	3.5e-46	0.9221789883268483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.10e-68	24	311	2	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	2.32e-24	32	289	9	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
224359	RfaJ	1.55e-13	95	289	75	244	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
279798	Glyco_transf_8	2.48e-13	32	293	8	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
215090	PLN00176	3.56e-12	34	308	35	288	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ65718.1|GT8	4.71e-144	24	328	13	318
UKZ91123.1|GT8	7.74e-143	23	328	12	318
QKD54215.1|GT8	3.95e-139	9	328	1	322
QYS97521.1|GT8	3.98e-138	23	328	12	318
CEI67220.1|GT8	4.58e-138	23	328	15	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	8.50e-14	25	296	10	246	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3USQ_A	4.28e-08	10	290	11	241	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCY_A	7.40e-08	10	290	11	241	Chain A, Glycogenin-1 [Oryctolagus cuniculus],1ZDG_A Chain A, Glycogenin-1 [Oryctolagus cuniculus]
3USR_A	7.69e-08	10	290	11	241	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCV_A	9.88e-08	10	290	11	241	Chain A, Glycogenin-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UNW1|YR707_MIMIV	4.00e-19	34	293	16	238	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|Q9FXB2|GOLS2_ARATH	1.92e-15	14	308	16	288	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|O22693|GOLS4_ARATH	4.02e-14	34	308	35	289	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|O22893|GOLS1_ARATH	1.45e-13	34	308	42	296	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|C7G304|GOLS2_SOLLC	4.64e-13	34	308	36	289	Galactinol synthase 2 OS=Solanum lycopersicum OX=4081 GN=GOLS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999902	0.000107

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8610-t41_1-p1.