CAZyme Information: SAPIO_CDS8355-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8355-t41_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		51342.89	4.4823

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000121:1018989-1020608(+)

Full Sequence      

MKSLRSVLLASIAAAPAMAVLPKDLDVNDPGKPDPFSLSLCRILERHINFLVEGVASNVA
SNLMSYYAPENSTVQTIGTFFPFVDFWTAGAVWSSLIEYQHFTGDKSYNEAIIAALTAPD
NLGPNKDYHYNESIAFPAGDDVATWGLAALTAAERNFPQPEKDLPSWLTLSQNSFNFLTS
LWDNETCGGGIVWQLNPSLSSTGVWKSTLVTGAVLQMAARLARATGDKDGSLVQWANKIW
DWTDEVGFINDEYAVYDGANPELDCSTPSRVQWTHASGLHILGAAVMANHTGDAKWTERA
TKLIDHASEVFFRASSKEGGIDPGDILTETACEAGLMCTHSMNAMKGLLASAMWRAAQMV
PALDAKVRPLLTASAKAAAAKCTAGKNQDRCQSYWAMDSLSMVGPGEQLSVLNVVQGLLI
AEADAPYAEGQITEVTDPNGSSKPGSGGSGGSDNEDESGAVGKRMSVAVVMGSLMVAVFG
LL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS8355-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	52	427	7.8e-71	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.93e-100	55	412	5	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	6.31e-06	140	318	93	247	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC22573.1|GH76	6.23e-99	10	433	12	411
QLI64344.1|GH76	4.65e-96	14	437	11	410
UPK97622.1|GH76	5.98e-96	9	443	9	420
UKZ85257.1|GH76	1.46e-95	1	437	1	413
UKZ47137.1|GH76	1.77e-92	52	446	31	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.78e-56	87	439	77	423	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	4.31e-69	52	439	30	405	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	4.45e-65	52	427	29	390	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.57e-61	52	447	32	405	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.24e-60	38	445	12	405	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q9P6I4|YHG6_SCHPO	1.06e-56	52	423	31	384	Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.06c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999696	CS pos: 19-20. Pr: 0.9367

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8355-t41_1-p1.