CAZyme Information: SAPIO_CDS8298-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8298-t41_1-p1
• CAZy Family: GH81
• CAZyme Description: FAD binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		65643.10	4.7246

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000121:817985-819931(+)

Full Sequence      

MGRLMSLAASALLALQTVTVQAAKCPAGLVPRVWEGKQYGCKCYVGDDCWPKSKEWKTLN
STVDGNLVIHVPPEAACHNTFEGPLGTLETYDAERCAEVTANYAAEQWTTDQDALNLWKY
FTNATCTPTENPEEPCTLGYYGVYVVLAKEHAHIKAGVDFARKHNLRLIIRNTGHDFIGR
STGWGALIINTHVFQDIDFLDSFTGPGDYDGPAVKIGAGVQGRELIRTVAAKGLAVVTGE
CPTVGVAGGFIQGGGHGPLTTLYGMAADQVLEFDILTVDGEYKTVNAGNEPELFWALKGG
GPSTYAIVLTVTVRAYPELPSAAADLFVNFTSISDPDVFWEGVRIFHKHSNHFVDSGLYV
YFEIGPMLFRAKPFVAVNQTAAQLEAILAPMVADFEASGVPHELSVFEYQSLHDLYLDRF
EDEGAGAFALTGGWLFTHRDVEENNDEIIEAFKTVLSPREDLVNQGFMVGHLFNAGHNLP
VARSATHPLWRKGTDFIISILPVPQNASVAEKADLQDVLTNVQDAALRAAGPYGASYVNE
ADPFQPNWQEHFWGDIYPDLKTLKKKWDPRGILYAVSTPGTEEWEVIEYGTRLCKRIE

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	139	332	7.6e-45	0.39956331877729256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.52e-14	144	286	3	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.84e-13	144	573	34	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	4.60e-08	536	575	1	40	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	7.33e-45	26	596	485	1066
QKD57322.1|CBM91|GH43_11	7.33e-45	26	596	485	1066
UPK90596.1|AA7	1.61e-14	145	572	23	434
CAE7194773.1|AA7|CBM18	2.31e-13	138	340	131	325
UQC87672.1|AA7	4.25e-12	138	394	66	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.37e-92	41	595	28	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	9.32e-57	41	584	30	587	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
2BVF_A	8.04e-18	154	335	51	222	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
4PVJ_A	2.97e-16	143	321	54	228	Phl p 4 I153V variant, a glucose oxidase [Phleum pratense],4PWB_A Phl p 4 I153V variant, a glucose oxidase, pressurized with Xenon [Phleum pratense]
3TSH_A	2.97e-16	143	321	54	228	Crystal structure of Phl p 4, a grass pollen allergen with glucose dehydrogenase activity [Phleum pratense],3TSJ_A Crystal structure of Phl p 4, a grass pollen allergen with glucose dehydrogenase activity [Phleum pratense],3TSJ_B Crystal structure of Phl p 4, a grass pollen allergen with glucose dehydrogenase activity [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	1.58e-114	41	595	27	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|G0R6T3|SORD_HYPJQ	1.90e-100	36	595	34	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A075TR33|PATO_PENEN	2.64e-95	30	595	17	566	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	1.72e-92	41	595	29	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	7.06e-92	41	595	28	573	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999740	CS pos: 22-23. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8298-t41_1-p1.