CAZyme Information: SAPIO_CDS8224-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8224-t41_1-p1
• CAZy Family: GH78
• CAZyme Description: Carbohydrate esterase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	JOWA01000121|CGC10	25133.65	4.3122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000121:563507-564345(+)

Full Sequence      

MHLSKLSVVMGLALAASAQKIKFLPLGDSITEITCWRADVWDMLAAEGLTDEVDFVGSQT
NNPQNCRAESGNFDTGHEGHSGWQAVDIANNYIDGWVEKTVPDIVNFMLGTNDVNMGKTV
PQIIGAYDKMLASMRAANPKVKVIIDKIIPLPFKNGPIVEVNGLIPDWVETNSTPESPIV
IADCSEDNGFMASMLRDGVHPNAAGDTLIADQVGPLLIKYIKDVIAERGGGAAE

Enzyme Prediction     

EC	3.1.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	21	211	7.2e-51	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.05e-43	21	211	1	151	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.24e-13	26	205	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.58e-11	26	216	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	4.77e-08	99	205	46	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238860	Lysophospholipase_L1_like	8.43e-08	93	217	56	176	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59370.1|CE3	4.22e-89	18	227	28	235
QBZ60834.1|CE3	1.53e-83	3	229	7	230
AEO64701.1|CE3	1.16e-81	19	226	29	235
CAP86604.1|CE3	6.29e-80	1	230	1	227
VBB73025.1|CBM1|CE3	2.87e-79	7	229	7	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	2.29e-78	21	224	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	6.54e-78	21	224	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.11e-07	14	205	37	248	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999718	CS pos: 18-19. Pr: 0.9674

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8224-t41_1-p1.