CAZyme Information: SAPIO_CDS8185-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS8185-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: Alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		68412.91	4.6396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000121:413641-416051(+)

Full Sequence      

MAPKRYPTLSGALVALLGVTGIYARPSRCKSRAVGDPQILAADEVEEEYDYIIVGGGTAG
LTVADRLTESGEHTVLVIEWGAYDNGTSVNTIAGGAGAFANQSHLFSFTSAPQTGLNNRT
TAVIGGLMLGGSSGVNGLQVHRGHKDDYNRWNAYFGESNDSDWSWDGLLPYFKKAWHFHA
PNEDTAEALDIKYDKSYWGEAGDVHASFPTFNWPGLRVEMEAFGEIEGVEFPPDSGAGSP
GVYWYPTSADPTTMARSFSRTGHYDGISRDNYKVLTGHRVLNVVFDEDDAASGVRYVAKG
AKGDADARSVSARKEVILAAGTIHTPQILQGSGIGAEELLKSAGIEVRVDLPGVGWNFQD
HPLGGGASFDLADFPVSPQPGDLQSNASFREEAQAEFSESRSGPLTIASGNAACFLPLPV
IAPSTFEDIASRYEAQDPASHLPPNSPPTIVAGYSAQQKAMAAAMRSHGSAYYNLFLRGG
GSEGAIVFLHPASRGTVYVNPADPYFSEPVVDYRAMSNPVDVDIEVEFVKFTRRYFTETS
MSEYGALESRPGEGVQSDEEIRDYVRANVSPSTFHPVGTSAMLPRELGGVVDQELRVYGV
KRLSVVDASVMPDLPGAYTQQTAFAIAEKAADLIKARA

Enzyme Prediction     

No EC number prediction in SAPIO_CDS8185-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	48	636	9e-164	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.76e-76	46	638	3	535	choline dehydrogenase; Validated
225186	BetA	1.82e-73	42	638	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.79e-32	491	630	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	8.84e-30	50	634	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	7.34e-18	135	362	33	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73730.1|AA3_2	6.29e-274	5	638	3	647
AEO58401.1|AA3_2	8.36e-247	31	638	28	635
VBB80399.1|AA3_2	6.01e-201	9	635	4	628
CDP28753.1|AA3_2	2.82e-196	9	629	4	619
AEO63808.1|AA3_2	3.89e-191	44	635	35	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	2.37e-111	44	634	31	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	2.23e-107	45	635	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	5.91e-59	48	636	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.06e-58	48	636	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.08e-56	48	634	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.24e-93	48	635	37	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.11e-81	7	635	2	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.15e-77	47	634	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.15e-77	47	634	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A142PTM2|CITC_MONPU	2.84e-67	39	635	4	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.512205	0.487783

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS8185-t41_1-p1.