CAZyme Information: SAPIO_CDS7989-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS7989-t41_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: Glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41368.79	6.2313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000115:49224-50504(-)

Full Sequence      

MHQHERTLSSGLAQLRHHVTRRWNRRLTIAGVALFMTVVLWTYGGSALDISGLPPDDRLA
HKDSTEKTSSYLPQPTAGAHAIENCRSDWRTQNPSADTGSQIPQKIWQISLSKQSAKDSV
VDPEKLQDTASWLAMNTDYTYTLVGDKGGKEFVKSRFADEPKIVELYNSLPNVGMKSDLL
RYLILYVEGGVYTDIDTIALKPIDTWVPLELRDQVRMVVGIEFDRRDGGPWADIPHWLQF
CQWTIAAAPGHPVFRKMAARALESMNALSDEHGIPVRKLKPTSFEVMNSTGPAAWTDVVF
EQLQEYDPTLNTTKDLSFMTESKLYGDILVLTIDGFGMGQAHSESTNDGSIPEVALAKHL
FRGSWRHDN

Enzyme Prediction     

No EC number prediction in SAPIO_CDS7989-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	129	208	3.3e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.62e-24	102	297	82	281	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.50e-17	131	208	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX53490.1|GT32	5.21e-159	13	369	12	362
UKZ83874.1|GT32	2.59e-138	10	366	11	350
QYT06191.1|GT32	1.97e-135	10	368	11	352
UKZ94407.1|GT32	1.98e-133	10	368	11	354
UKZ69802.1|GT32	7.50e-131	1	368	1	353

PDB Hits     

SAPIO_CDS7989-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.19e-45	100	368	140	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.45e-38	97	368	94	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	4.58e-32	97	368	91	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.38e-29	97	367	125	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994448	0.005561

TMHMM  Annotations     

Start	End
23	45