CAZyme Information: SAPIO_CDS7894-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS7894-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: Glycoside hydrolase family 75

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	JOWA01000112|CGC1	30809.11	4.1924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000112:69180-70109(+)

Full Sequence      

MVFLSLLAFLLLAASGLARDVPDNVRELYDSIRKKGKCSHKLATGFWSDDNGSNSFSYCG
DHLDDYNIVYIQGTRGALANMDVDCDGAQGGQADDGRCASSNDTQYVSSFQDTVESYRQG
IKDLNANIHPYIVFGNEGSKRGWATFDPREHGIEPLSIMAVVCGDKLIYGVWGDTNGDDG
PRPMVGEAAISVATACFGSGVSGDNGYDDDDVLYIAFTGQDAVPGSQGANWSATNYEIFE
KSIQDQGDTLIERIGSTGARFAVPVGSLWRGSMIPLLVSLIFTTSLT

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	252	1.3e-75	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.25e-89	81	253	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60909.1|GH75	3.03e-123	6	255	6	255
BAA12799.1|GH75|3.2.1.132	1.67e-118	11	257	12	258
UNI20522.1|GH75	7.51e-118	18	258	20	260
ABX57824.1|GH75|3.2.1.132	8.38e-118	11	257	12	258
QUC16007.1|GH75	1.15e-117	12	271	14	274

PDB Hits     

SAPIO_CDS7894-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	5.47e-70	12	256	10	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.01e-65	12	251	11	240	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.01e-65	12	251	11	240	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.68e-62	12	251	11	236	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	1.72e-59	12	251	11	233	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999743	CS pos: 18-19. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS7894-t41_1-p1.